Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 26450..26719 Replicon plasmid p3
Accession NZ_CP101880
Organism Klebsiella pneumoniae strain KPA1

Toxin (Protein)


Gene name hok Uniprot ID G9G195
Locus tag NNX43_RS27105 Protein ID WP_001323520.1
Coordinates 26603..26719 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 26450..26515 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNX43_RS27060 21619..22593 + 975 WP_004187382.1 plasmid segregation protein ParM -
NNX43_RS27065 22596..23039 + 444 WP_004187380.1 plasmid partitioning/stability family protein -
NNX43_RS27070 23049..23612 + 564 WP_019725065.1 phospholipase D family protein -
NNX43_RS27075 23730..24236 + 507 WP_004187377.1 hypothetical protein -
NNX43_RS27080 24229..24708 + 480 WP_004187375.1 hypothetical protein -
NNX43_RS27085 24737..25147 + 411 WP_004206907.1 hypothetical protein -
NNX43_RS27090 25265..25528 + 264 WP_004187372.1 hypothetical protein -
- 26305..26517 + 213 NuclAT_0 - -
- 26305..26517 + 213 NuclAT_0 - -
- 26305..26517 + 213 NuclAT_0 - -
- 26305..26517 + 213 NuclAT_0 - -
- 26450..26515 - 66 - - Antitoxin
NNX43_RS27100 26503..26652 + 150 Protein_39 plasmid maintenance protein Mok -
NNX43_RS27105 26603..26719 + 117 WP_001323520.1 type I toxin-antitoxin system Hok family toxin Toxin
NNX43_RS27110 27020..27316 - 297 Protein_41 hypothetical protein -
NNX43_RS27115 27616..27912 + 297 WP_001272251.1 hypothetical protein -
NNX43_RS27120 28023..28844 + 822 WP_001234445.1 DUF932 domain-containing protein -
NNX43_RS27125 29141..29731 - 591 WP_000252683.1 transglycosylase SLT domain-containing protein -
NNX43_RS27130 30064..30447 + 384 WP_001151529.1 conjugal transfer relaxosome DNA-binding protein TraM -
NNX43_RS27135 30639..31286 + 648 WP_000332523.1 transcriptional regulator TraJ family protein -
NNX43_RS27140 31406..31633 + 228 WP_000589556.1 conjugal transfer relaxosome protein TraY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-48 - 1..68908 68908


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(1-34)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4455.23 Da        Isoelectric Point: 8.5110

>T252850 WP_001323520.1 NZ_CP101880:26603-26719 [Klebsiella pneumoniae]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 117 bp

Antitoxin


Download         Length: 66 bp

>AT252850 NZ_CP101880:c26515-26450 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G195

Antitoxin

Download structure file

References