Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328623..329209 Replicon chromosome
Accession NZ_CP101877
Organism Klebsiella pneumoniae strain KPA1

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NNX43_RS01535 Protein ID WP_023285605.1
Coordinates 328841..329209 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NNX43_RS01530 Protein ID WP_004174006.1
Coordinates 328623..328844 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNX43_RS01510 (324780) 324780..325706 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NNX43_RS01515 (325703) 325703..326980 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NNX43_RS01520 (326977) 326977..327744 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NNX43_RS01525 (327746) 327746..328459 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NNX43_RS01530 (328623) 328623..328844 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NNX43_RS01535 (328841) 328841..329209 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NNX43_RS01540 (329482) 329482..330798 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NNX43_RS01545 (330905) 330905..331792 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NNX43_RS01550 (331789) 331789..332634 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NNX43_RS01555 (332636) 332636..333706 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325703..334443 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T252831 WP_023285605.1 NZ_CP101877:328841-329209 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT252831 WP_004174006.1 NZ_CP101877:328623-328844 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References