Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 105604..105858 | Replicon | plasmid pLP5-1-106kb |
| Accession | NZ_CP101867 | ||
| Organism | Escherichia coli strain LP5-1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPX81_RS22835 | Protein ID | WP_001312851.1 |
| Coordinates | 105709..105858 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 105604..105665 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX81_RS22820 (103557) | 103557..104300 | + | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
| NPX81_RS22825 (104355) | 104355..104915 | + | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| NPX81_RS22830 (105050) | 105050..105262 | + | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| - (105604) | 105604..105665 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (105604) | 105604..105665 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (105604) | 105604..105665 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (105604) | 105604..105665 | - | 62 | NuclAT_1 | - | Antitoxin |
| NPX81_RS22835 (105709) | 105709..105858 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NPX81_RS22840 (106126) | 106126..106383 | + | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| NPX81_RS22845 (106486) | 106486..106669 | + | 184 | Protein_130 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mef(B) / aph(3')-Ia | - | 1..106681 | 106681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252828 WP_001312851.1 NZ_CP101867:105709-105858 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT252828 NZ_CP101867:c105665-105604 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|