Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 70281..70550 | Replicon | plasmid pLP5-1-106kb |
Accession | NZ_CP101867 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | NPX81_RS22640 | Protein ID | WP_001372321.1 |
Coordinates | 70425..70550 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 70281..70346 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS22595 | 65355..65582 | + | 228 | WP_071961421.1 | hypothetical protein | - |
NPX81_RS22600 | 65823..66029 | + | 207 | WP_000275853.1 | hypothetical protein | - |
NPX81_RS22605 | 66055..66594 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
NPX81_RS22610 | 66651..66884 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
NPX81_RS22615 | 66949..68907 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
NPX81_RS22620 | 68962..69396 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
NPX81_RS22625 | 69393..70155 | + | 763 | Protein_86 | plasmid SOS inhibition protein A | - |
NPX81_RS22630 | 70124..70312 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 70124..70348 | + | 225 | NuclAT_0 | - | - |
- | 70124..70348 | + | 225 | NuclAT_0 | - | - |
- | 70124..70348 | + | 225 | NuclAT_0 | - | - |
- | 70124..70348 | + | 225 | NuclAT_0 | - | - |
- | 70281..70346 | - | 66 | - | - | Antitoxin |
NPX81_RS22635 | 70334..70483 | + | 150 | Protein_88 | plasmid maintenance protein Mok | - |
NPX81_RS22640 | 70425..70550 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
NPX81_RS22645 | 70770..71000 | + | 231 | WP_001426396.1 | hypothetical protein | - |
NPX81_RS22650 | 70998..71171 | - | 174 | Protein_91 | hypothetical protein | - |
NPX81_RS22655 | 71241..71447 | + | 207 | WP_000547968.1 | hypothetical protein | - |
NPX81_RS22660 | 71472..71759 | + | 288 | WP_000107535.1 | hypothetical protein | - |
NPX81_RS22665 | 71881..72702 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
NPX81_RS22670 | 72999..73601 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
NPX81_RS22675 | 73922..74305 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
NPX81_RS22680 | 74492..75181 | + | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mef(B) / aph(3')-Ia | - | 1..106681 | 106681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T252826 WP_001372321.1 NZ_CP101867:70425-70550 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT252826 NZ_CP101867:c70346-70281 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|