Detailed information of TA system TA252825

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 70124..70550
• Replicon: plasmid pLP5-1-106kb
• Accession: NZ_CP101867
• Organism: Escherichia coli strain LP5-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NPX81_RS22640
• Protein ID: WP_001372321.1
• Coordinates: 70425..70550 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	70124..70348 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NPX81_RS22595 (65355)	65355..65582	+	228	WP_071961421.1	hypothetical protein	-
NPX81_RS22600 (65823)	65823..66029	+	207	WP_000275853.1	hypothetical protein	-
NPX81_RS22605 (66055)	66055..66594	+	540	WP_032332913.1	single-stranded DNA-binding protein	-
NPX81_RS22610 (66651)	66651..66884	+	234	WP_000005987.1	DUF905 family protein	-
NPX81_RS22615 (66949)	66949..68907	+	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
NPX81_RS22620 (68962)	68962..69396	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NPX81_RS22625 (69393)	69393..70155	+	763	Protein_86	plasmid SOS inhibition protein A	-
NPX81_RS22630 (70124)	70124..70312	-	189	WP_001299721.1	hypothetical protein	-
- (70124)	70124..70348	+	225	NuclAT_0	-	Antitoxin
- (70124)	70124..70348	+	225	NuclAT_0	-	Antitoxin
- (70124)	70124..70348	+	225	NuclAT_0	-	Antitoxin
- (70124)	70124..70348	+	225	NuclAT_0	-	Antitoxin
NPX81_RS22635 (70334)	70334..70483	+	150	Protein_88	plasmid maintenance protein Mok	-
NPX81_RS22640 (70425)	70425..70550	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NPX81_RS22645 (70770)	70770..71000	+	231	WP_001426396.1	hypothetical protein	-
NPX81_RS22650 (70998)	70998..71171	-	174	Protein_91	hypothetical protein	-
NPX81_RS22655 (71241)	71241..71447	+	207	WP_000547968.1	hypothetical protein	-
NPX81_RS22660 (71472)	71472..71759	+	288	WP_000107535.1	hypothetical protein	-
NPX81_RS22665 (71881)	71881..72702	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NPX81_RS22670 (72999)	72999..73601	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NPX81_RS22675 (73922)	73922..74305	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NPX81_RS22680 (74492)	74492..75181	+	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mef(B) / aph(3')-Ia	-	1..106681	106681

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252825 WP_001372321.1 NZ_CP101867:70425-70550 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT252825 NZ_CP101867:70124-70348 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin