Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4382679..4383281 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NPX81_RS21275 | Protein ID | WP_000897305.1 |
Coordinates | 4382970..4383281 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NPX81_RS21270 | Protein ID | WP_000356397.1 |
Coordinates | 4382679..4382969 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS21245 (4378607) | 4378607..4379509 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
NPX81_RS21250 (4379506) | 4379506..4380141 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NPX81_RS21255 (4380138) | 4380138..4381067 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NPX81_RS21260 (4381396) | 4381396..4381638 | - | 243 | WP_024199136.1 | CopG family transcriptional regulator | - |
NPX81_RS21265 (4381857) | 4381857..4382075 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NPX81_RS21270 (4382679) | 4382679..4382969 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NPX81_RS21275 (4382970) | 4382970..4383281 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NPX81_RS21280 (4383510) | 4383510..4384418 | + | 909 | WP_001491417.1 | alpha/beta hydrolase | - |
NPX81_RS21285 (4384587) | 4384587..4385501 | - | 915 | Protein_4155 | transposase | - |
NPX81_RS21290 (4385514) | 4385514..4386401 | - | 888 | Protein_4156 | hypothetical protein | - |
NPX81_RS21295 (4386811) | 4386811..4387752 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NPX81_RS21300 (4387797) | 4387797..4388234 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T252823 WP_000897305.1 NZ_CP101866:c4383281-4382970 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|