Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3841044..3841302 | Replicon | chromosome |
Accession | NZ_CP101866 | ||
Organism | Escherichia coli strain LP5-1 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | NPX81_RS18720 | Protein ID | WP_000809168.1 |
Coordinates | 3841150..3841302 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3841044..3841101 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX81_RS18705 | 3837436..3838395 | + | 960 | WP_000871692.1 | hypothetical protein | - |
NPX81_RS18710 | 3838433..3839332 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
NPX81_RS18715 | 3839398..3840564 | - | 1167 | WP_000681368.1 | Na+/H+ antiporter NhaA | - |
- | 3841044..3841101 | - | 58 | - | - | Antitoxin |
NPX81_RS18720 | 3841150..3841302 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
NPX81_RS18725 | 3841406..3842536 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
NPX81_RS18730 | 3842625..3844541 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
NPX81_RS18735 | 3844918..3845322 | + | 405 | WP_000843568.1 | DUF2541 family protein | - |
NPX81_RS18740 | 3845348..3846061 | + | 714 | WP_001102367.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T252820 WP_000809168.1 NZ_CP101866:3841150-3841302 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT252820 NZ_CP101866:c3841101-3841044 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|