Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 100405..100659 Replicon plasmid pLP50-1-101kb
Accession NZ_CP101859
Organism Escherichia coli strain LP50-1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NPX80_RS24110 Protein ID WP_001312851.1
Coordinates 100510..100659 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 100405..100466 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX80_RS24080 (96050) 96050..96523 + 474 WP_001389366.1 trimethoprim-resistant dihydrofolate reductase DfrA17 -
NPX80_RS24085 (96654) 96654..97442 + 789 WP_000503573.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA5 -
NPX80_RS24090 (97729) 97729..98433 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
NPX80_RS24095 (98816) 98816..99518 + 703 Protein_123 IS6 family transposase -
NPX80_RS24100 (99617) 99617..99829 + 213 WP_001299730.1 ANR family transcriptional regulator -
NPX80_RS24105 (100075) 100075..100149 + 75 Protein_125 endonuclease -
- (100405) 100405..100466 - 62 NuclAT_1 - Antitoxin
- (100405) 100405..100466 - 62 NuclAT_1 - Antitoxin
- (100405) 100405..100466 - 62 NuclAT_1 - Antitoxin
- (100405) 100405..100466 - 62 NuclAT_1 - Antitoxin
NPX80_RS24110 (100510) 100510..100659 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NPX80_RS24115 (100943) 100943..101200 + 258 WP_000083845.1 replication regulatory protein RepA -
NPX80_RS24120 (101217) 101217..101468 - 252 WP_223195197.1 replication protein RepA -
NPX80_RS24125 (101459) 101459..101506 + 48 WP_229471593.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / sitABCD / tet(A) / aac(3)-IId / aadA5 iutA / iucD / iucC / iucB / iucA 1..101973 101973


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252797 WP_001312851.1 NZ_CP101859:100510-100659 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT252797 NZ_CP101859:c100466-100405 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References