Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 100405..100659 | Replicon | plasmid pLP50-1-101kb |
| Accession | NZ_CP101859 | ||
| Organism | Escherichia coli strain LP50-1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPX80_RS24110 | Protein ID | WP_001312851.1 |
| Coordinates | 100510..100659 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 100405..100466 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX80_RS24080 (96050) | 96050..96523 | + | 474 | WP_001389366.1 | trimethoprim-resistant dihydrofolate reductase DfrA17 | - |
| NPX80_RS24085 (96654) | 96654..97442 | + | 789 | WP_000503573.1 | ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA5 | - |
| NPX80_RS24090 (97729) | 97729..98433 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NPX80_RS24095 (98816) | 98816..99518 | + | 703 | Protein_123 | IS6 family transposase | - |
| NPX80_RS24100 (99617) | 99617..99829 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NPX80_RS24105 (100075) | 100075..100149 | + | 75 | Protein_125 | endonuclease | - |
| - (100405) | 100405..100466 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (100405) | 100405..100466 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (100405) | 100405..100466 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (100405) | 100405..100466 | - | 62 | NuclAT_1 | - | Antitoxin |
| NPX80_RS24110 (100510) | 100510..100659 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NPX80_RS24115 (100943) | 100943..101200 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NPX80_RS24120 (101217) | 101217..101468 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| NPX80_RS24125 (101459) | 101459..101506 | + | 48 | WP_229471593.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / sitABCD / tet(A) / aac(3)-IId / aadA5 | iutA / iucD / iucC / iucB / iucA | 1..101973 | 101973 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252797 WP_001312851.1 NZ_CP101859:100510-100659 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT252797 NZ_CP101859:c100466-100405 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|