Detailed information of TA system TA252794

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 20584..21010
• Replicon: plasmid pLP50-1-101kb
• Accession: NZ_CP101859
• Organism: Escherichia coli strain LP50-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NPX80_RS23640
• Protein ID: WP_001372321.1
• Coordinates: 20584..20709 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	20786..21010 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NPX80_RS23600 (15958)	15958..16647	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NPX80_RS23605 (16834)	16834..17217	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NPX80_RS23610 (17538)	17538..18140	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NPX80_RS23615 (18437)	18437..19258	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NPX80_RS23620 (19376)	19376..19663	-	288	WP_000107535.1	hypothetical protein	-
NPX80_RS23625 (19688)	19688..19894	-	207	WP_000547968.1	hypothetical protein	-
NPX80_RS23630 (19964)	19964..20136	+	173	Protein_30	hypothetical protein	-
NPX80_RS23635 (20134)	20134..20364	-	231	WP_071586998.1	hypothetical protein	-
NPX80_RS23640 (20584)	20584..20709	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NPX80_RS23645 (20651)	20651..20800	-	150	Protein_33	plasmid maintenance protein Mok	-
- (20786)	20786..21010	-	225	NuclAT_0	-	Antitoxin
- (20786)	20786..21010	-	225	NuclAT_0	-	Antitoxin
- (20786)	20786..21010	-	225	NuclAT_0	-	Antitoxin
- (20786)	20786..21010	-	225	NuclAT_0	-	Antitoxin
NPX80_RS23650 (20822)	20822..21010	+	189	WP_001299721.1	hypothetical protein	-
NPX80_RS23655 (20979)	20979..21741	-	763	Protein_35	plasmid SOS inhibition protein A	-
NPX80_RS23660 (21738)	21738..22172	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NPX80_RS23665 (22227)	22227..22424	-	198	Protein_37	hypothetical protein	-
NPX80_RS23670 (22452)	22452..22685	-	234	WP_000005987.1	DUF905 family protein	-
NPX80_RS23675 (22753)	22753..23292	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NPX80_RS23680 (23318)	23318..23524	-	207	WP_000275856.1	hypothetical protein	-
NPX80_RS23685 (23594)	23594..23674	+	81	Protein_41	hypothetical protein	-
NPX80_RS23690 (23857)	23857..24026	-	170	Protein_42	hypothetical protein	-
NPX80_RS23695 (24620)	24620..25591	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / sitABCD / tet(A) / aac(3)-IId / aadA5	iutA / iucD / iucC / iucB / iucA	1..101973	101973

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252794 WP_001372321.1 NZ_CP101859:c20709-20584 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT252794 NZ_CP101859:c21010-20786 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin