Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3225020..3225622 | Replicon | chromosome |
Accession | NZ_CP101858 | ||
Organism | Escherichia coli strain LP50-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NPX80_RS15660 | Protein ID | WP_000897305.1 |
Coordinates | 3225020..3225331 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NPX80_RS15665 | Protein ID | WP_000356397.1 |
Coordinates | 3225332..3225622 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX80_RS15630 (3220050) | 3220050..3220835 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NPX80_RS15635 (3220934) | 3220934..3221533 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
NPX80_RS15640 (3221527) | 3221527..3222399 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NPX80_RS15645 (3222396) | 3222396..3222833 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NPX80_RS15650 (3222878) | 3222878..3223819 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NPX80_RS15655 (3223883) | 3223883..3224791 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NPX80_RS15660 (3225020) | 3225020..3225331 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NPX80_RS15665 (3225332) | 3225332..3225622 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NPX80_RS15670 (3226227) | 3226227..3226445 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
NPX80_RS15675 (3226665) | 3226665..3226907 | + | 243 | WP_001087409.1 | protein YiiF | - |
NPX80_RS15680 (3227237) | 3227237..3228166 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NPX80_RS15685 (3228163) | 3228163..3228798 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NPX80_RS15690 (3228795) | 3228795..3229697 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T252788 WP_000897305.1 NZ_CP101858:3225020-3225331 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|