Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2422660..2423459 | Replicon | chromosome |
Accession | NZ_CP101858 | ||
Organism | Escherichia coli strain LP50-1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | NPX80_RS11770 | Protein ID | WP_000347266.1 |
Coordinates | 2422995..2423459 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NPX80_RS11765 | Protein ID | WP_001307405.1 |
Coordinates | 2422660..2422995 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPX80_RS11750 (2418445) | 2418445..2419215 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
NPX80_RS11755 (2419231) | 2419231..2420565 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
NPX80_RS11760 (2420940) | 2420940..2422511 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
NPX80_RS11765 (2422660) | 2422660..2422995 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NPX80_RS11770 (2422995) | 2422995..2423459 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NPX80_RS11775 (2423514) | 2423514..2424323 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
NPX80_RS11780 (2424572) | 2424572..2425852 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NPX80_RS11785 (2425875) | 2425875..2426348 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NPX80_RS11790 (2426359) | 2426359..2427138 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NPX80_RS11795 (2427128) | 2427128..2428006 | + | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NPX80_RS11800 (2428024) | 2428024..2428458 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2410393..2423459 | 13066 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T252785 WP_000347266.1 NZ_CP101858:2422995-2423459 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |