Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 460024..460395 | Replicon | chromosome |
| Accession | NZ_CP101858 | ||
| Organism | Escherichia coli strain LP50-1 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | NPX80_RS02315 | Protein ID | WP_001317028.1 |
| Coordinates | 460201..460395 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 460024..460202 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX80_RS02290 (455979) | 455979..457352 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
| NPX80_RS02295 (457481) | 457481..458416 | - | 936 | WP_242808441.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| NPX80_RS02300 (458468) | 458468..459703 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
| NPX80_RS02305 (459705) | 459705..459920 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (460024) | 460024..460202 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (460024) | 460024..460202 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (460024) | 460024..460202 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (460024) | 460024..460202 | + | 179 | NuclAT_0 | - | Antitoxin |
| NPX80_RS02310 (459999) | 459999..460208 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| NPX80_RS02315 (460201) | 460201..460395 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| NPX80_RS02320 (460452) | 460452..461261 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| NPX80_RS02325 (461254) | 461254..463854 | - | 2601 | WP_001532611.1 | exodeoxyribonuclease VIII | - |
| NPX80_RS02330 (463956) | 463956..464231 | - | 276 | WP_000632297.1 | protein RacC | - |
| NPX80_RS02335 (464306) | 464306..464476 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| NPX80_RS02340 (464476) | 464476..464697 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 458468..487699 | 29231 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T252771 WP_001317028.1 NZ_CP101858:c460395-460201 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT252771 NZ_CP101858:460024-460202 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|