Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 322793..323013 Replicon chromosome
Accession NZ_CP101858
Organism Escherichia coli strain LP50-1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A8S7XT81
Locus tag NPX80_RS01615 Protein ID WP_074147554.1
Coordinates 322793..322900 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 322947..323013 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX80_RS01585 318648..319481 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
NPX80_RS01590 319478..319870 + 393 WP_000200378.1 invasion regulator SirB2 -
NPX80_RS01595 319874..320683 + 810 WP_001257044.1 invasion regulator SirB1 -
NPX80_RS01600 320719..321573 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
NPX80_RS01605 321722..321829 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 321877..321943 + 67 NuclAT_50 - -
- 321877..321943 + 67 NuclAT_50 - -
- 321877..321943 + 67 NuclAT_50 - -
- 321877..321943 + 67 NuclAT_50 - -
- 321877..321943 + 67 NuclAT_53 - -
- 321877..321943 + 67 NuclAT_53 - -
- 321877..321943 + 67 NuclAT_53 - -
- 321877..321943 + 67 NuclAT_53 - -
- 321879..321942 + 64 NuclAT_15 - -
- 321879..321942 + 64 NuclAT_15 - -
- 321879..321942 + 64 NuclAT_15 - -
- 321879..321942 + 64 NuclAT_15 - -
- 321879..321942 + 64 NuclAT_18 - -
- 321879..321942 + 64 NuclAT_18 - -
- 321879..321942 + 64 NuclAT_18 - -
- 321879..321942 + 64 NuclAT_18 - -
- 321879..321942 + 64 NuclAT_21 - -
- 321879..321942 + 64 NuclAT_21 - -
- 321879..321942 + 64 NuclAT_21 - -
- 321879..321942 + 64 NuclAT_21 - -
- 321879..321942 + 64 NuclAT_24 - -
- 321879..321942 + 64 NuclAT_24 - -
- 321879..321942 + 64 NuclAT_24 - -
- 321879..321942 + 64 NuclAT_24 - -
- 321879..321942 + 64 NuclAT_27 - -
- 321879..321942 + 64 NuclAT_27 - -
- 321879..321942 + 64 NuclAT_27 - -
- 321879..321942 + 64 NuclAT_27 - -
- 321879..321942 + 64 NuclAT_30 - -
- 321879..321942 + 64 NuclAT_30 - -
- 321879..321942 + 64 NuclAT_30 - -
- 321879..321942 + 64 NuclAT_30 - -
- 321879..321944 + 66 NuclAT_33 - -
- 321879..321944 + 66 NuclAT_33 - -
- 321879..321944 + 66 NuclAT_33 - -
- 321879..321944 + 66 NuclAT_33 - -
- 321879..321944 + 66 NuclAT_36 - -
- 321879..321944 + 66 NuclAT_36 - -
- 321879..321944 + 66 NuclAT_36 - -
- 321879..321944 + 66 NuclAT_36 - -
- 321879..321944 + 66 NuclAT_39 - -
- 321879..321944 + 66 NuclAT_39 - -
- 321879..321944 + 66 NuclAT_39 - -
- 321879..321944 + 66 NuclAT_39 - -
- 321879..321944 + 66 NuclAT_42 - -
- 321879..321944 + 66 NuclAT_42 - -
- 321879..321944 + 66 NuclAT_42 - -
- 321879..321944 + 66 NuclAT_42 - -
- 321879..321944 + 66 NuclAT_45 - -
- 321879..321944 + 66 NuclAT_45 - -
- 321879..321944 + 66 NuclAT_45 - -
- 321879..321944 + 66 NuclAT_45 - -
- 321879..321944 + 66 NuclAT_48 - -
- 321879..321944 + 66 NuclAT_48 - -
- 321879..321944 + 66 NuclAT_48 - -
- 321879..321944 + 66 NuclAT_48 - -
NPX80_RS01610 322257..322364 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 322417..322478 + 62 NuclAT_16 - -
- 322417..322478 + 62 NuclAT_16 - -
- 322417..322478 + 62 NuclAT_16 - -
- 322417..322478 + 62 NuclAT_16 - -
- 322417..322478 + 62 NuclAT_19 - -
- 322417..322478 + 62 NuclAT_19 - -
- 322417..322478 + 62 NuclAT_19 - -
- 322417..322478 + 62 NuclAT_19 - -
- 322417..322478 + 62 NuclAT_22 - -
- 322417..322478 + 62 NuclAT_22 - -
- 322417..322478 + 62 NuclAT_22 - -
- 322417..322478 + 62 NuclAT_22 - -
- 322417..322478 + 62 NuclAT_25 - -
- 322417..322478 + 62 NuclAT_25 - -
- 322417..322478 + 62 NuclAT_25 - -
- 322417..322478 + 62 NuclAT_25 - -
- 322417..322478 + 62 NuclAT_28 - -
- 322417..322478 + 62 NuclAT_28 - -
- 322417..322478 + 62 NuclAT_28 - -
- 322417..322478 + 62 NuclAT_28 - -
- 322417..322478 + 62 NuclAT_31 - -
- 322417..322478 + 62 NuclAT_31 - -
- 322417..322478 + 62 NuclAT_31 - -
- 322417..322478 + 62 NuclAT_31 - -
- 322417..322479 + 63 NuclAT_51 - -
- 322417..322479 + 63 NuclAT_51 - -
- 322417..322479 + 63 NuclAT_51 - -
- 322417..322479 + 63 NuclAT_51 - -
- 322417..322479 + 63 NuclAT_54 - -
- 322417..322479 + 63 NuclAT_54 - -
- 322417..322479 + 63 NuclAT_54 - -
- 322417..322479 + 63 NuclAT_54 - -
- 322417..322480 + 64 NuclAT_34 - -
- 322417..322480 + 64 NuclAT_34 - -
- 322417..322480 + 64 NuclAT_34 - -
- 322417..322480 + 64 NuclAT_34 - -
- 322417..322480 + 64 NuclAT_37 - -
- 322417..322480 + 64 NuclAT_37 - -
- 322417..322480 + 64 NuclAT_37 - -
- 322417..322480 + 64 NuclAT_37 - -
- 322417..322480 + 64 NuclAT_40 - -
- 322417..322480 + 64 NuclAT_40 - -
- 322417..322480 + 64 NuclAT_40 - -
- 322417..322480 + 64 NuclAT_40 - -
- 322417..322480 + 64 NuclAT_43 - -
- 322417..322480 + 64 NuclAT_43 - -
- 322417..322480 + 64 NuclAT_43 - -
- 322417..322480 + 64 NuclAT_43 - -
- 322417..322480 + 64 NuclAT_46 - -
- 322417..322480 + 64 NuclAT_46 - -
- 322417..322480 + 64 NuclAT_46 - -
- 322417..322480 + 64 NuclAT_46 - -
- 322417..322480 + 64 NuclAT_49 - -
- 322417..322480 + 64 NuclAT_49 - -
- 322417..322480 + 64 NuclAT_49 - -
- 322417..322480 + 64 NuclAT_49 - -
NPX80_RS01615 322793..322900 - 108 WP_074147554.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 322947..323013 + 67 - - Antitoxin
NPX80_RS01620 323305..324405 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
NPX80_RS01625 324675..324905 + 231 WP_001146442.1 putative cation transport regulator ChaB -
NPX80_RS01630 325063..325758 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
NPX80_RS01635 325802..326155 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
NPX80_RS01640 326340..327734 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T252770 WP_074147554.1 NZ_CP101858:c322900-322793 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT252770 NZ_CP101858:322947-323013 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References