Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 771479..772254 | Replicon | chromosome |
Accession | NZ_CP101835 | ||
Organism | Klebsiella pneumoniae strain GN4549 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NPH93_RS03900 | Protein ID | WP_004150910.1 |
Coordinates | 771769..772254 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NPH93_RS03895 | Protein ID | WP_004150912.1 |
Coordinates | 771479..771772 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPH93_RS03875 (NPH93_03875) | 766687..767289 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
NPH93_RS03880 (NPH93_03880) | 767387..768298 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NPH93_RS03885 (NPH93_03885) | 768299..769447 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NPH93_RS03890 (NPH93_03890) | 769458..770834 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NPH93_RS03895 (NPH93_03895) | 771479..771772 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NPH93_RS03900 (NPH93_03900) | 771769..772254 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NPH93_RS03905 (NPH93_03905) | 772958..773551 | + | 594 | WP_004188553.1 | hypothetical protein | - |
NPH93_RS03910 (NPH93_03910) | 773648..773864 | + | 217 | Protein_769 | transposase | - |
NPH93_RS03915 (NPH93_03915) | 774470..775342 | + | 873 | WP_004188557.1 | ParA family protein | - |
NPH93_RS03920 (NPH93_03920) | 775342..775725 | + | 384 | WP_004150906.1 | hypothetical protein | - |
NPH93_RS03925 (NPH93_03925) | 775718..777085 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 773648..773800 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T252745 WP_004150910.1 NZ_CP101835:771769-772254 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |