Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 350582..351228 | Replicon | chromosome |
Accession | NZ_CP101835 | ||
Organism | Klebsiella pneumoniae strain GN4549 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W8UNE1 |
Locus tag | NPH93_RS01615 | Protein ID | WP_002920560.1 |
Coordinates | 350582..350929 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | NPH93_RS01620 | Protein ID | WP_002920557.1 |
Coordinates | 350929..351228 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPH93_RS01605 (NPH93_01605) | 346508..347941 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
NPH93_RS01610 (NPH93_01610) | 347959..350406 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
NPH93_RS01615 (NPH93_01615) | 350582..350929 | + | 348 | WP_002920560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NPH93_RS01620 (NPH93_01620) | 350929..351228 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NPH93_RS01625 (NPH93_01625) | 351291..352799 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
NPH93_RS01630 (NPH93_01630) | 353004..353333 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NPH93_RS01635 (NPH93_01635) | 353384..354214 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
NPH93_RS01640 (NPH93_01640) | 354264..355022 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13502.56 Da Isoelectric Point: 6.2300
>T252744 WP_002920560.1 NZ_CP101835:350582-350929 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBY5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |