Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 1356293..1356857 | Replicon | chromosome |
| Accession | NZ_CP101831 | ||
| Organism | Lacticaseibacillus paracasei strain SMN-LBK | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A510WIJ9 |
| Locus tag | NPC72_RS06840 | Protein ID | WP_016363448.1 |
| Coordinates | 1356555..1356857 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | K6SLT0 |
| Locus tag | NPC72_RS06835 | Protein ID | WP_003570051.1 |
| Coordinates | 1356293..1356562 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPC72_RS06805 (NPC72_06805) | 1351298..1352185 | - | 888 | WP_003570041.1 | ABC transporter ATP-binding protein | - |
| NPC72_RS06810 (NPC72_06810) | 1352382..1353608 | - | 1227 | WP_003570043.1 | hypothetical protein | - |
| NPC72_RS06815 (NPC72_06815) | 1353806..1354210 | + | 405 | WP_003570045.1 | MerR family transcriptional regulator | - |
| NPC72_RS06820 (NPC72_06820) | 1354203..1354529 | + | 327 | WP_003584272.1 | YrdB family protein | - |
| NPC72_RS06825 (NPC72_06825) | 1354592..1355221 | + | 630 | WP_003570047.1 | DUF2399 domain-containing protein | - |
| NPC72_RS06830 (NPC72_06830) | 1355266..1355919 | + | 654 | WP_003570049.1 | N-acetyltransferase | - |
| NPC72_RS06835 (NPC72_06835) | 1356293..1356562 | + | 270 | WP_003570051.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NPC72_RS06840 (NPC72_06840) | 1356555..1356857 | + | 303 | WP_016363448.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NPC72_RS06845 (NPC72_06845) | 1357196..1357339 | + | 144 | WP_162259784.1 | hypothetical protein | - |
| NPC72_RS06850 (NPC72_06850) | 1357457..1358149 | + | 693 | WP_003570055.1 | hypothetical protein | - |
| NPC72_RS06855 (NPC72_06855) | 1358385..1360562 | + | 2178 | WP_003570057.1 | Tex family protein | - |
| NPC72_RS06860 (NPC72_06860) | 1360987..1361544 | - | 558 | WP_003584278.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11510.33 Da Isoelectric Point: 9.8881
>T252739 WP_016363448.1 NZ_CP101831:1356555-1356857 [Lacticaseibacillus paracasei]
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
MYSLVPTPTFKRDLKRLSKKHWPMDELKTAVNLLAAGTNAELLSKKYADHALSSSSEWKGYRELYVDGPRGDWLLIYKIE
QQDLILTLVRTGSHHNLLVK
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A510WIJ9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2BRK6 |