Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 660450..660966 | Replicon | chromosome |
Accession | NZ_CP101831 | ||
Organism | Lacticaseibacillus paracasei strain SMN-LBK |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A243Q0H7 |
Locus tag | NPC72_RS03220 | Protein ID | WP_003573774.1 |
Coordinates | 660685..660966 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | NPC72_RS03215 | Protein ID | WP_016363783.1 |
Coordinates | 660450..660692 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPC72_RS03200 (NPC72_03200) | 655904..658075 | - | 2172 | WP_003607130.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
NPC72_RS03205 (NPC72_03205) | 658247..659236 | + | 990 | WP_003586769.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
NPC72_RS03210 (NPC72_03210) | 659233..659718 | + | 486 | WP_003586772.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
NPC72_RS03215 (NPC72_03215) | 660450..660692 | + | 243 | WP_016363783.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NPC72_RS03220 (NPC72_03220) | 660685..660966 | + | 282 | WP_003573774.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NPC72_RS03225 (NPC72_03225) | 661166..661564 | + | 399 | WP_003586778.1 | DUF1722 domain-containing protein | - |
NPC72_RS03230 (NPC72_03230) | 661809..662918 | - | 1110 | WP_003607129.1 | hypothetical protein | - |
NPC72_RS03235 (NPC72_03235) | 662920..664350 | - | 1431 | WP_003607128.1 | hypothetical protein | - |
NPC72_RS03240 (NPC72_03240) | 664540..665223 | + | 684 | WP_003586785.1 | IS6 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 556832..689532 | 132700 | |
- | flank | IS/Tn | - | - | 654323..655738 | 1415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11371.98 Da Isoelectric Point: 9.5081
>T252738 WP_003573774.1 NZ_CP101831:660685-660966 [Lacticaseibacillus paracasei]
MNKFVYKPAFERQFKKHYKTILKGGRYKKEDFEAVYHKLLRDEPLDPHYNDHALVNRKPERDLHIKPDWLLIYKYDGEFV
RFIDTGSHSDLFN
MNKFVYKPAFERQFKKHYKTILKGGRYKKEDFEAVYHKLLRDEPLDPHYNDHALVNRKPERDLHIKPDWLLIYKYDGEFV
RFIDTGSHSDLFN
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|