Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3872652..3873249 | Replicon | chromosome |
Accession | NZ_CP101790 | ||
Organism | Klebsiella pneumoniae strain hvKP859 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | NPJ86_RS18950 | Protein ID | WP_004142563.1 |
Coordinates | 3872932..3873249 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | NPJ86_RS18945 | Protein ID | WP_004142561.1 |
Coordinates | 3872652..3872939 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ86_RS18915 (NPJ86_18915) | 3868732..3868980 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
NPJ86_RS18920 (NPJ86_18920) | 3868998..3869339 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
NPJ86_RS18925 (NPJ86_18925) | 3869370..3870485 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
NPJ86_RS18930 (NPJ86_18930) | 3870665..3871246 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
NPJ86_RS18935 (NPJ86_18935) | 3871246..3871614 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
NPJ86_RS18940 (NPJ86_18940) | 3871734..3872387 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NPJ86_RS18945 (NPJ86_18945) | 3872652..3872939 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NPJ86_RS18950 (NPJ86_18950) | 3872932..3873249 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NPJ86_RS18955 (NPJ86_18955) | 3873434..3874477 | - | 1044 | WP_020802450.1 | DUF2157 domain-containing protein | - |
NPJ86_RS18960 (NPJ86_18960) | 3875147..3876013 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
NPJ86_RS18965 (NPJ86_18965) | 3876122..3877549 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T252726 WP_004142563.1 NZ_CP101790:c3873249-3872932 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |