Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 29854..30581 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP101786 | ||
| Organism | Klebsiella pneumoniae strain hvKP841 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NPJ85_RS27865 | Protein ID | WP_011251285.1 |
| Coordinates | 29854..30165 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NPJ85_RS27870 | Protein ID | WP_011251286.1 |
| Coordinates | 30162..30581 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ85_RS27840 (NPJ85_27840) | 25373..25867 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| NPJ85_RS27845 (NPJ85_27845) | 26045..26311 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| NPJ85_RS27850 (NPJ85_27850) | 26344..26994 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| NPJ85_RS27860 (NPJ85_27860) | 29212..29649 | + | 438 | Protein_33 | DDE-type integrase/transposase/recombinase | - |
| NPJ85_RS27865 (NPJ85_27865) | 29854..30165 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NPJ85_RS27870 (NPJ85_27870) | 30162..30581 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NPJ85_RS27875 (NPJ85_27875) | 30728..31696 | + | 969 | WP_011251287.1 | IS5 family transposase | - |
| NPJ85_RS27880 (NPJ85_27880) | 31768..32133 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| NPJ85_RS27885 (NPJ85_27885) | 32147..32935 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| NPJ85_RS27890 (NPJ85_27890) | 32956..33576 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| NPJ85_RS27895 (NPJ85_27895) | 33995..34630 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| NPJ85_RS27900 (NPJ85_27900) | 34943..35413 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..190034 | 190034 | |
| - | inside | IScluster/Tn | - | - | 13130..38421 | 25291 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T252713 WP_011251285.1 NZ_CP101786:29854-30165 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT252713 WP_011251286.1 NZ_CP101786:30162-30581 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|