Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 133381..133634 Replicon plasmid unnamed1
Accession NZ_CP101785
Organism Klebsiella pneumoniae strain hvKP841

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NPJ85_RS27680 Protein ID WP_001312851.1
Coordinates 133485..133634 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 133381..133440 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ85_RS27635 (128414) 128414..128719 + 306 WP_004144424.1 type IV conjugative transfer system protein TraL -
NPJ85_RS27640 (128739) 128739..129104 + 366 Protein_161 type IV conjugative transfer system protein TraE -
NPJ85_RS27645 (129159) 129159..129863 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NPJ85_RS27650 (129888) 129888..130088 + 201 WP_072354025.1 hypothetical protein -
NPJ85_RS27655 (130108) 130108..130854 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NPJ85_RS27660 (130909) 130909..131469 + 561 WP_000139328.1 fertility inhibition protein FinO -
NPJ85_RS27665 (131601) 131601..131801 + 201 WP_015059022.1 hypothetical protein -
NPJ85_RS27670 (132187) 132187..132786 + 600 WP_032083981.1 PIN domain-containing protein -
NPJ85_RS27675 (132848) 132848..133180 + 333 WP_152916585.1 hypothetical protein -
- (133381) 133381..133440 - 60 NuclAT_1 - Antitoxin
- (133381) 133381..133440 - 60 NuclAT_1 - Antitoxin
- (133381) 133381..133440 - 60 NuclAT_1 - Antitoxin
- (133381) 133381..133440 - 60 NuclAT_1 - Antitoxin
NPJ85_RS27680 (133485) 133485..133634 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NPJ85_RS27685 (133918) 133918..134166 + 249 WP_000083837.1 replication regulatory protein RepA -
NPJ85_RS27690 (134281) 134281..134465 + 185 Protein_171 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..134477 134477
- flank IS/Tn - - 129159..129863 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252710 WP_001312851.1 NZ_CP101785:133485-133634 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT252710 NZ_CP101785:c133440-133381 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References