Detailed information of TA system TA252708

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35049..35318
• Replicon: plasmid unnamed1
• Accession: NZ_CP101785
• Organism: Klebsiella pneumoniae strain hvKP841

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NPJ85_RS27070
• Protein ID: WP_001372321.1
• Coordinates: 35193..35318 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	35049..35114 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NPJ85_RS27040	30759..31286	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NPJ85_RS27045	31344..31577	+	234	WP_000006003.1	DUF905 family protein	-
NPJ85_RS27050	31638..33661	+	2024	Protein_43	ParB/RepB/Spo0J family partition protein	-
NPJ85_RS27055	33730..34164	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NPJ85_RS27060	34161..34880	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	34892..35116	+	225	NuclAT_0	-	-
-	34892..35116	+	225	NuclAT_0	-	-
-	34892..35116	+	225	NuclAT_0	-	-
-	34892..35116	+	225	NuclAT_0	-	-
-	35049..35114	-	66	-	-	Antitoxin
NPJ85_RS27065	35102..35251	+	150	Protein_46	plasmid maintenance protein Mok	-
NPJ85_RS27070	35193..35318	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NPJ85_RS27075	35637..35933	-	297	Protein_48	hypothetical protein	-
NPJ85_RS27080	36233..36529	+	297	WP_001272251.1	hypothetical protein	-
NPJ85_RS27085	36640..37461	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NPJ85_RS27090	37758..38405	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NPJ85_RS27095	38682..39065	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NPJ85_RS27100	39346..40050	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2	-	1..134477	134477

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252708 WP_001372321.1 NZ_CP101785:35193-35318 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT252708 NZ_CP101785:c35114-35049 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin