Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 110853..111106 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP101782 | ||
| Organism | Klebsiella pneumoniae strain hvKP340 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPJ84_RS29880 | Protein ID | WP_001312851.1 |
| Coordinates | 110957..111106 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 110853..110912 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ84_RS29835 (105886) | 105886..106191 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| NPJ84_RS29840 (106211) | 106211..106576 | + | 366 | Protein_143 | type IV conjugative transfer system protein TraE | - |
| NPJ84_RS29845 (106631) | 106631..107335 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NPJ84_RS29850 (107360) | 107360..107560 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NPJ84_RS29855 (107580) | 107580..108326 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NPJ84_RS29860 (108381) | 108381..108941 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NPJ84_RS29865 (109073) | 109073..109273 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NPJ84_RS29870 (109659) | 109659..110258 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NPJ84_RS29875 (110320) | 110320..110652 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (110853) | 110853..110912 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (110853) | 110853..110912 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (110853) | 110853..110912 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (110853) | 110853..110912 | - | 60 | NuclAT_1 | - | Antitoxin |
| NPJ84_RS29880 (110957) | 110957..111106 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NPJ84_RS29885 (111390) | 111390..111638 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NPJ84_RS29890 (111753) | 111753..111937 | + | 185 | Protein_153 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 106631..107335 | 704 | |
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..111949 | 111949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252690 WP_001312851.1 NZ_CP101782:110957-111106 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252690 NZ_CP101782:c110912-110853 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|