Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 110853..111106 Replicon plasmid unnamed6
Accession NZ_CP101782
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NPJ84_RS29880 Protein ID WP_001312851.1
Coordinates 110957..111106 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 110853..110912 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS29835 (105886) 105886..106191 + 306 WP_004144424.1 type IV conjugative transfer system protein TraL -
NPJ84_RS29840 (106211) 106211..106576 + 366 Protein_143 type IV conjugative transfer system protein TraE -
NPJ84_RS29845 (106631) 106631..107335 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NPJ84_RS29850 (107360) 107360..107560 + 201 WP_072354025.1 hypothetical protein -
NPJ84_RS29855 (107580) 107580..108326 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NPJ84_RS29860 (108381) 108381..108941 + 561 WP_000139328.1 fertility inhibition protein FinO -
NPJ84_RS29865 (109073) 109073..109273 + 201 WP_015059022.1 hypothetical protein -
NPJ84_RS29870 (109659) 109659..110258 + 600 WP_032083981.1 PIN domain-containing protein -
NPJ84_RS29875 (110320) 110320..110652 + 333 WP_152916585.1 hypothetical protein -
- (110853) 110853..110912 - 60 NuclAT_1 - Antitoxin
- (110853) 110853..110912 - 60 NuclAT_1 - Antitoxin
- (110853) 110853..110912 - 60 NuclAT_1 - Antitoxin
- (110853) 110853..110912 - 60 NuclAT_1 - Antitoxin
NPJ84_RS29880 (110957) 110957..111106 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NPJ84_RS29885 (111390) 111390..111638 + 249 WP_000083837.1 replication regulatory protein RepA -
NPJ84_RS29890 (111753) 111753..111937 + 185 Protein_153 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 106631..107335 704
- inside Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..111949 111949


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252690 WP_001312851.1 NZ_CP101782:110957-111106 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT252690 NZ_CP101782:c110912-110853 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References