Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 133381..133634 | Replicon | plasmid unnamed5 |
Accession | NZ_CP101775 | ||
Organism | Klebsiella pneumoniae strain hvKP323 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | NO368_RS29435 | Protein ID | WP_001312851.1 |
Coordinates | 133485..133634 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 133381..133440 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO368_RS29390 (128414) | 128414..128719 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
NO368_RS29395 (128739) | 128739..129104 | + | 366 | Protein_161 | type IV conjugative transfer system protein TraE | - |
NO368_RS29400 (129159) | 129159..129863 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
NO368_RS29405 (129888) | 129888..130088 | + | 201 | WP_072354025.1 | hypothetical protein | - |
NO368_RS29410 (130108) | 130108..130854 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
NO368_RS29415 (130909) | 130909..131469 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
NO368_RS29420 (131601) | 131601..131801 | + | 201 | WP_015059022.1 | hypothetical protein | - |
NO368_RS29425 (132187) | 132187..132786 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
NO368_RS29430 (132848) | 132848..133180 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (133381) | 133381..133440 | - | 60 | NuclAT_1 | - | Antitoxin |
- (133381) | 133381..133440 | - | 60 | NuclAT_1 | - | Antitoxin |
- (133381) | 133381..133440 | - | 60 | NuclAT_1 | - | Antitoxin |
- (133381) | 133381..133440 | - | 60 | NuclAT_1 | - | Antitoxin |
NO368_RS29435 (133485) | 133485..133634 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
NO368_RS29440 (133918) | 133918..134166 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
NO368_RS29445 (134281) | 134281..134465 | + | 185 | Protein_171 | protein CopA/IncA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..134477 | 134477 | |
- | flank | IS/Tn | - | - | 129159..129863 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252664 WP_001312851.1 NZ_CP101775:133485-133634 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252664 NZ_CP101775:c133440-133381 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|