Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 29846..30573 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP101774 | ||
| Organism | Klebsiella pneumoniae strain hvKP323 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NO368_RS27695 | Protein ID | WP_011251285.1 |
| Coordinates | 29846..30157 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NO368_RS27700 | Protein ID | WP_011251286.1 |
| Coordinates | 30154..30573 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO368_RS27670 (NO368_27670) | 25365..25859 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| NO368_RS27675 (NO368_27675) | 26037..26303 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| NO368_RS27680 (NO368_27680) | 26336..26986 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| NO368_RS27690 (NO368_27690) | 29204..29641 | + | 438 | Protein_33 | DDE-type integrase/transposase/recombinase | - |
| NO368_RS27695 (NO368_27695) | 29846..30157 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NO368_RS27700 (NO368_27700) | 30154..30573 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NO368_RS27705 (NO368_27705) | 30720..31688 | + | 969 | WP_086642568.1 | IS5 family transposase | - |
| NO368_RS27710 (NO368_27710) | 31760..32125 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| NO368_RS27715 (NO368_27715) | 32139..32927 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| NO368_RS27720 (NO368_27720) | 32948..33568 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| NO368_RS27725 (NO368_27725) | 33987..34622 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| NO368_RS27730 (NO368_27730) | 34935..35405 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..190026 | 190026 | |
| - | inside | IScluster/Tn | - | - | 13390..38413 | 25023 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T252658 WP_011251285.1 NZ_CP101774:29846-30157 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT252658 WP_011251286.1 NZ_CP101774:30154-30573 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|