Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 329100..329686 | Replicon | chromosome |
Accession | NZ_CP101770 | ||
Organism | Klebsiella pneumoniae strain hvKP323 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | NO368_RS01535 | Protein ID | WP_002920800.1 |
Coordinates | 329318..329686 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0H3GZM4 |
Locus tag | NO368_RS01530 | Protein ID | WP_002920802.1 |
Coordinates | 329100..329321 (+) | Length | 74 a.a. |
Genomic Context
Location: 325257..326183 (927 bp)
Type: Others
Protein ID: WP_002920807.1
Type: Others
Protein ID: WP_002920807.1
Location: 326180..327457 (1278 bp)
Type: Others
Protein ID: WP_002920806.1
Type: Others
Protein ID: WP_002920806.1
Location: 327454..328221 (768 bp)
Type: Others
Protein ID: WP_002920803.1
Type: Others
Protein ID: WP_002920803.1
Location: 328223..328936 (714 bp)
Type: Others
Protein ID: WP_004145133.1
Type: Others
Protein ID: WP_004145133.1
Location: 329100..329321 (222 bp)
Type: Antitoxin
Protein ID: WP_002920802.1
Type: Antitoxin
Protein ID: WP_002920802.1
Location: 329318..329686 (369 bp)
Type: Toxin
Protein ID: WP_002920800.1
Type: Toxin
Protein ID: WP_002920800.1
Location: 329959..331275 (1317 bp)
Type: Others
Protein ID: WP_002920796.1
Type: Others
Protein ID: WP_002920796.1
Location: 331382..332269 (888 bp)
Type: Others
Protein ID: WP_002920792.1
Type: Others
Protein ID: WP_002920792.1
Location: 332266..333111 (846 bp)
Type: Others
Protein ID: WP_002920789.1
Type: Others
Protein ID: WP_002920789.1
Location: 333113..334183 (1071 bp)
Type: Others
Protein ID: WP_002920787.1
Type: Others
Protein ID: WP_002920787.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO368_RS01510 (NO368_01510) | 325257..326183 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NO368_RS01515 (NO368_01515) | 326180..327457 | + | 1278 | WP_002920806.1 | branched chain amino acid ABC transporter permease LivM | - |
NO368_RS01520 (NO368_01520) | 327454..328221 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NO368_RS01525 (NO368_01525) | 328223..328936 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NO368_RS01530 (NO368_01530) | 329100..329321 | + | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NO368_RS01535 (NO368_01535) | 329318..329686 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NO368_RS01540 (NO368_01540) | 329959..331275 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NO368_RS01545 (NO368_01545) | 331382..332269 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NO368_RS01550 (NO368_01550) | 332266..333111 | + | 846 | WP_002920789.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NO368_RS01555 (NO368_01555) | 333113..334183 | + | 1071 | WP_002920787.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 326180..334920 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T252641 WP_002920800.1 NZ_CP101770:329318-329686 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZM4 |