Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 126080..126333 Replicon plasmid unnamed2
Accession NZ_CP101766
Organism Klebsiella pneumoniae strain hvKP319

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NPJ83_RS29455 Protein ID WP_001312851.1
Coordinates 126184..126333 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 126080..126139 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ83_RS29410 (121113) 121113..121418 + 306 WP_004144424.1 type IV conjugative transfer system protein TraL -
NPJ83_RS29415 (121438) 121438..121803 + 366 Protein_152 type IV conjugative transfer system protein TraE -
NPJ83_RS29420 (121858) 121858..122562 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NPJ83_RS29425 (122587) 122587..122787 + 201 WP_072354025.1 hypothetical protein -
NPJ83_RS29430 (122807) 122807..123553 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NPJ83_RS29435 (123608) 123608..124168 + 561 WP_000139328.1 fertility inhibition protein FinO -
NPJ83_RS29440 (124300) 124300..124500 + 201 WP_015059022.1 hypothetical protein -
NPJ83_RS29445 (124886) 124886..125485 + 600 WP_032083981.1 PIN domain-containing protein -
NPJ83_RS29450 (125547) 125547..125879 + 333 WP_152916585.1 hypothetical protein -
- (126080) 126080..126139 - 60 NuclAT_1 - Antitoxin
- (126080) 126080..126139 - 60 NuclAT_1 - Antitoxin
- (126080) 126080..126139 - 60 NuclAT_1 - Antitoxin
- (126080) 126080..126139 - 60 NuclAT_1 - Antitoxin
NPJ83_RS29455 (126184) 126184..126333 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NPJ83_RS29460 (126617) 126617..126865 + 249 WP_000083837.1 replication regulatory protein RepA -
NPJ83_RS29465 (126980) 126980..127164 + 185 Protein_162 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 - 1..127176 127176
- flank IS/Tn - - 121858..122562 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252637 WP_001312851.1 NZ_CP101766:126184-126333 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT252637 NZ_CP101766:c126139-126080 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References