Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 126080..126333 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP101766 | ||
| Organism | Klebsiella pneumoniae strain hvKP319 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPJ83_RS29455 | Protein ID | WP_001312851.1 |
| Coordinates | 126184..126333 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 126080..126139 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ83_RS29410 (121113) | 121113..121418 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| NPJ83_RS29415 (121438) | 121438..121803 | + | 366 | Protein_152 | type IV conjugative transfer system protein TraE | - |
| NPJ83_RS29420 (121858) | 121858..122562 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NPJ83_RS29425 (122587) | 122587..122787 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NPJ83_RS29430 (122807) | 122807..123553 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NPJ83_RS29435 (123608) | 123608..124168 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NPJ83_RS29440 (124300) | 124300..124500 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NPJ83_RS29445 (124886) | 124886..125485 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NPJ83_RS29450 (125547) | 125547..125879 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (126080) | 126080..126139 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (126080) | 126080..126139 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (126080) | 126080..126139 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (126080) | 126080..126139 | - | 60 | NuclAT_1 | - | Antitoxin |
| NPJ83_RS29455 (126184) | 126184..126333 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NPJ83_RS29460 (126617) | 126617..126865 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NPJ83_RS29465 (126980) | 126980..127164 | + | 185 | Protein_162 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 | - | 1..127176 | 127176 | |
| - | flank | IS/Tn | - | - | 121858..122562 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252637 WP_001312851.1 NZ_CP101766:126184-126333 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252637 NZ_CP101766:c126139-126080 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|