Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 193147..193874 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP101765 | ||
| Organism | Klebsiella pneumoniae strain hvKP319 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | NPJ83_RS27765 | Protein ID | WP_011251285.1 |
| Coordinates | 193147..193458 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NPJ83_RS27770 | Protein ID | WP_011251286.1 |
| Coordinates | 193455..193874 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ83_RS27740 (188666) | 188666..189160 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| NPJ83_RS27745 (189338) | 189338..189604 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| NPJ83_RS27750 (189637) | 189637..190287 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| NPJ83_RS27760 (192505) | 192505..192942 | + | 438 | Protein_236 | DDE-type integrase/transposase/recombinase | - |
| NPJ83_RS27765 (193147) | 193147..193458 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NPJ83_RS27770 (193455) | 193455..193874 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NPJ83_RS27775 (194021) | 194021..194989 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| NPJ83_RS27780 (195061) | 195061..195426 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| NPJ83_RS27785 (195440) | 195440..196228 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| NPJ83_RS27790 (196249) | 196249..196869 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| NPJ83_RS27795 (197288) | 197288..197923 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| NPJ83_RS27800 (198236) | 198236..198706 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..353327 | 353327 | |
| - | inside | IScluster/Tn | - | - | 186480..201714 | 15234 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T252631 WP_011251285.1 NZ_CP101765:193147-193458 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT252631 WP_011251286.1 NZ_CP101765:193455-193874 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|