Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 93436..93689 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP101765 | ||
| Organism | Klebsiella pneumoniae strain hvKP319 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPJ83_RS27140 | Protein ID | WP_001312851.1 |
| Coordinates | 93436..93585 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 93630..93689 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ83_RS27105 (88795) | 88795..89210 | - | 416 | Protein_105 | IS1 family transposase | - |
| NPJ83_RS27110 (89459) | 89459..89860 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NPJ83_RS27115 (89793) | 89793..90050 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NPJ83_RS27120 (90143) | 90143..90796 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NPJ83_RS27125 (91735) | 91735..92592 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NPJ83_RS27130 (92611) | 92611..92789 | - | 179 | Protein_110 | protein CopA/IncA | - |
| NPJ83_RS27135 (92904) | 92904..93152 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NPJ83_RS27140 (93436) | 93436..93585 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (93630) | 93630..93689 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (93630) | 93630..93689 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (93630) | 93630..93689 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (93630) | 93630..93689 | + | 60 | NuclAT_1 | - | Antitoxin |
| NPJ83_RS27145 (93890) | 93890..94222 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| NPJ83_RS27150 (94284) | 94284..94883 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NPJ83_RS27155 (95269) | 95269..95469 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| NPJ83_RS27160 (95601) | 95601..96161 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NPJ83_RS27165 (96216) | 96216..96962 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NPJ83_RS27170 (96982) | 96982..97182 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| NPJ83_RS27175 (97207) | 97207..97911 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NPJ83_RS27180 (97966) | 97966..98331 | - | 366 | Protein_120 | type IV conjugative transfer system protein TraE | - |
| NPJ83_RS27185 (98351) | 98351..98656 | - | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..353327 | 353327 | |
| - | flank | IS/Tn | - | - | 97207..97911 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252627 WP_001312851.1 NZ_CP101765:c93585-93436 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252627 NZ_CP101765:93630-93689 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
