Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57275..57701 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP101765 | ||
| Organism | Klebsiella pneumoniae strain hvKP319 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NPJ83_RS26895 | Protein ID | WP_001372321.1 |
| Coordinates | 57275..57400 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 57477..57701 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ83_RS26865 (52543) | 52543..53247 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NPJ83_RS26870 (53528) | 53528..53911 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NPJ83_RS26875 (54188) | 54188..54835 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| NPJ83_RS26880 (55132) | 55132..55953 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| NPJ83_RS26885 (56064) | 56064..56360 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| NPJ83_RS26890 (56660) | 56660..56956 | + | 297 | Protein_62 | hypothetical protein | - |
| NPJ83_RS26895 (57275) | 57275..57400 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NPJ83_RS26900 (57342) | 57342..57491 | - | 150 | Protein_64 | plasmid maintenance protein Mok | - |
| - (57477) | 57477..57701 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (57477) | 57477..57701 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (57477) | 57477..57701 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (57477) | 57477..57701 | - | 225 | NuclAT_0 | - | Antitoxin |
| NPJ83_RS26905 (57713) | 57713..58432 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| NPJ83_RS26910 (58429) | 58429..58863 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| NPJ83_RS26915 (58932) | 58932..60955 | - | 2024 | Protein_67 | ParB/RepB/Spo0J family partition protein | - |
| NPJ83_RS26920 (61016) | 61016..61249 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| NPJ83_RS26925 (61307) | 61307..61834 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| NPJ83_RS26930 (62136) | 62136..62591 | + | 456 | Protein_70 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..353327 | 353327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T252624 WP_001372321.1 NZ_CP101765:c57400-57275 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT252624 NZ_CP101765:c57701-57477 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
