Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 5759083..5759705 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NOX82_RS25225 | Protein ID | WP_116422899.1 |
Coordinates | 5759083..5759397 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NOX82_RS25230 | Protein ID | WP_116422898.1 |
Coordinates | 5759400..5759705 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS25215 (NOX82_25215) | 5754565..5756904 | - | 2340 | WP_256512556.1 | AAA family ATPase | - |
NOX82_RS25220 (NOX82_25220) | 5757990..5758706 | + | 717 | WP_256512558.1 | hypothetical protein | - |
NOX82_RS25225 (NOX82_25225) | 5759083..5759397 | + | 315 | WP_116422899.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOX82_RS25230 (NOX82_25230) | 5759400..5759705 | + | 306 | WP_116422898.1 | helix-turn-helix domain-containing protein | Antitoxin |
NOX82_RS25235 (NOX82_25235) | 5759892..5761337 | + | 1446 | WP_256512561.1 | SulP family inorganic anion transporter | - |
NOX82_RS25240 (NOX82_25240) | 5761428..5761754 | + | 327 | WP_249919006.1 | hypothetical protein | - |
NOX82_RS25245 (NOX82_25245) | 5761848..5763389 | - | 1542 | WP_256512564.1 | cyclic diguanylate phosphodiesterase | - |
NOX82_RS25250 (NOX82_25250) | 5763558..5764070 | + | 513 | WP_256512566.1 | RDD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11779.49 Da Isoelectric Point: 8.5126
>T252605 WP_116422899.1 NZ_CP101752:5759083-5759397 [Pseudomonas citronellolis]
MIFIETPVFTRQILELVDDETYRRLQEDLTLHPDAGAVIAGTGGVRKIRIAANGHGKRGGARVIYYHFVSASHIAFLLAY
DKATQEDLTADQKKVLRQIIENWR
MIFIETPVFTRQILELVDDETYRRLQEDLTLHPDAGAVIAGTGGVRKIRIAANGHGKRGGARVIYYHFVSASHIAFLLAY
DKATQEDLTADQKKVLRQIIENWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|