Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3096237..3096850 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4Z0IS23 |
Locus tag | NOX82_RS13955 | Protein ID | WP_074979656.1 |
Coordinates | 3096237..3096533 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NOX82_RS13960 | Protein ID | WP_024128404.1 |
Coordinates | 3096542..3096850 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS13945 (NOX82_13945) | 3093448..3094614 | - | 1167 | WP_074979652.1 | efflux RND transporter periplasmic adaptor subunit | - |
NOX82_RS13950 (NOX82_13950) | 3094611..3096014 | - | 1404 | WP_256515090.1 | efflux transporter outer membrane subunit | - |
NOX82_RS13955 (NOX82_13955) | 3096237..3096533 | + | 297 | WP_074979656.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOX82_RS13960 (NOX82_13960) | 3096542..3096850 | + | 309 | WP_024128404.1 | HigA family addiction module antitoxin | Antitoxin |
NOX82_RS13965 (NOX82_13965) | 3097454..3098137 | - | 684 | WP_074979659.1 | response regulator transcription factor | - |
NOX82_RS13970 (NOX82_13970) | 3098242..3098931 | + | 690 | WP_074979712.1 | response regulator transcription factor | - |
NOX82_RS13975 (NOX82_13975) | 3098909..3100291 | + | 1383 | WP_256515091.1 | ATP-binding protein | - |
NOX82_RS13980 (NOX82_13980) | 3100562..3101128 | - | 567 | WP_256515092.1 | flavin reductase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11834.32 Da Isoelectric Point: 8.5983
>T252601 WP_074979656.1 NZ_CP101752:3096237-3096533 [Pseudomonas citronellolis]
MIGSFREAWLEAFFVRDRMPRQIPADIQERLFRKLQMLDDATTDADLRSPPSNHFERLQGRLRAYHSIRVNRQWRLVFHW
DGEKGEASDVYLDNHSYR
MIGSFREAWLEAFFVRDRMPRQIPADIQERLFRKLQMLDDATTDADLRSPPSNHFERLQGRLRAYHSIRVNRQWRLVFHW
DGEKGEASDVYLDNHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|