Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE(toxin) |
Location | 2952..3601 | Replicon | plasmid unnamed5 |
Accession | NZ_CP101748 | ||
Organism | Comamonas sp. C11 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NOX35_RS28455 | Protein ID | WP_256497121.1 |
Coordinates | 2952..3290 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NOX35_RS28460 | Protein ID | WP_256497122.1 |
Coordinates | 3287..3601 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX35_RS28445 (NOX35_28445) | 1..975 | + | 975 | WP_256497119.1 | tripartite tricarboxylate transporter substrate binding protein | - |
NOX35_RS28450 (NOX35_28450) | 987..2537 | + | 1551 | WP_256497120.1 | AMP-binding protein | - |
NOX35_RS28455 (NOX35_28455) | 2952..3290 | + | 339 | WP_256497121.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOX35_RS28460 (NOX35_28460) | 3287..3601 | + | 315 | WP_256497122.1 | helix-turn-helix domain-containing protein | Antitoxin |
NOX35_RS28465 (NOX35_28465) | 3699..4385 | - | 687 | WP_256497123.1 | 50S ribosome-binding GTPase | - |
NOX35_RS28470 (NOX35_28470) | 4388..5365 | - | 978 | WP_256497124.1 | 50S ribosome-binding GTPase | - |
NOX35_RS28475 (NOX35_28475) | 5603..6691 | + | 1089 | WP_256497125.1 | IS5 family transposase | - |
NOX35_RS28480 (NOX35_28480) | 6801..7526 | - | 726 | Protein_7 | IS30 family transposase | - |
NOX35_RS28485 (NOX35_28485) | 7571..7681 | - | 111 | Protein_8 | IS5/IS1182 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..19871 | 19871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13090.93 Da Isoelectric Point: 9.7324
>T252590 WP_256497121.1 NZ_CP101748:2952-3290 [Comamonas sp. C11]
MKAVFVELPAFERNRATYLSDDEFKEFQERLLKNPEAGDMIEGTGGLRKVRHGDPRRGKGTRGGLRVIYYWWSGGPQFWL
FTLYDKDELENLTPKQKATLKQLLKNELEARQ
MKAVFVELPAFERNRATYLSDDEFKEFQERLLKNPEAGDMIEGTGGLRKVRHGDPRRGKGTRGGLRVIYYWWSGGPQFWL
FTLYDKDELENLTPKQKATLKQLLKNELEARQ
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|