Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86293..86547 | Replicon | plasmid pVir_150040X1B1 |
| Accession | NZ_CP101728 | ||
| Organism | Klebsiella pneumoniae strain 150040X1B1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPN21_RS28300 | Protein ID | WP_001312851.1 |
| Coordinates | 86293..86442 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 86486..86547 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPN21_RS28270 (81575) | 81575..84580 | + | 3006 | WP_256153266.1 | Tn3-like element Tn3 family transposase | - |
| NPN21_RS28275 (84513) | 84513..84978 | - | 466 | Protein_78 | plasmid replication initiator RepA | - |
| NPN21_RS28280 (84971) | 84971..85453 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NPN21_RS28285 (85446) | 85446..85493 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NPN21_RS28290 (85484) | 85484..85735 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NPN21_RS28295 (85752) | 85752..86009 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NPN21_RS28300 (86293) | 86293..86442 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (86486) | 86486..86547 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (86486) | 86486..86547 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (86486) | 86486..86547 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (86486) | 86486..86547 | + | 62 | NuclAT_1 | - | Antitoxin |
| NPN21_RS28305 (86803) | 86803..86877 | - | 75 | Protein_84 | endonuclease | - |
| NPN21_RS28310 (87123) | 87123..87335 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NPN21_RS28315 (87471) | 87471..88031 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NPN21_RS28320 (88134) | 88134..88994 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NPN21_RS28325 (89053) | 89053..89799 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..172348 | 172348 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252573 WP_001312851.1 NZ_CP101728:c86442-86293 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT252573 NZ_CP101728:86486-86547 [Klebsiella pneumoniae]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|