Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 86293..86547 Replicon plasmid pVir_150040X1B1
Accession NZ_CP101728
Organism Klebsiella pneumoniae strain 150040X1B1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NPN21_RS28300 Protein ID WP_001312851.1
Coordinates 86293..86442 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 86486..86547 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPN21_RS28270 (81575) 81575..84580 + 3006 WP_256153266.1 Tn3-like element Tn3 family transposase -
NPN21_RS28275 (84513) 84513..84978 - 466 Protein_78 plasmid replication initiator RepA -
NPN21_RS28280 (84971) 84971..85453 - 483 WP_001273588.1 hypothetical protein -
NPN21_RS28285 (85446) 85446..85493 - 48 WP_229471593.1 hypothetical protein -
NPN21_RS28290 (85484) 85484..85735 + 252 WP_223195197.1 replication protein RepA -
NPN21_RS28295 (85752) 85752..86009 - 258 WP_000083845.1 replication regulatory protein RepA -
NPN21_RS28300 (86293) 86293..86442 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (86486) 86486..86547 + 62 NuclAT_1 - Antitoxin
- (86486) 86486..86547 + 62 NuclAT_1 - Antitoxin
- (86486) 86486..86547 + 62 NuclAT_1 - Antitoxin
- (86486) 86486..86547 + 62 NuclAT_1 - Antitoxin
NPN21_RS28305 (86803) 86803..86877 - 75 Protein_84 endonuclease -
NPN21_RS28310 (87123) 87123..87335 - 213 WP_001299730.1 ANR family transcriptional regulator -
NPN21_RS28315 (87471) 87471..88031 - 561 WP_000139315.1 fertility inhibition protein FinO -
NPN21_RS28320 (88134) 88134..88994 - 861 WP_000704513.1 alpha/beta hydrolase -
NPN21_RS28325 (89053) 89053..89799 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..172348 172348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252573 WP_001312851.1 NZ_CP101728:c86442-86293 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT252573 NZ_CP101728:86486-86547 [Klebsiella pneumoniae]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References