Detailed information of TA system TA252570

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 80676..80945
• Replicon: plasmid pCTXM65_150040X1B1
• Accession: NZ_CP101727
• Organism: Klebsiella pneumoniae strain 150040X1B1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NPN21_RS27455
• Protein ID: WP_001372321.1
• Coordinates: 80820..80945 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	80676..80741 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NPN21_RS27425	76386..76913	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NPN21_RS27430	76971..77204	+	234	WP_000006003.1	DUF905 family protein	-
NPN21_RS27435	77265..79288	+	2024	Protein_107	ParB/RepB/Spo0J family partition protein	-
NPN21_RS27440	79357..79791	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NPN21_RS27445	79788..80507	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	80519..80743	+	225	NuclAT_0	-	-
-	80519..80743	+	225	NuclAT_0	-	-
-	80519..80743	+	225	NuclAT_0	-	-
-	80519..80743	+	225	NuclAT_0	-	-
-	80676..80741	-	66	-	-	Antitoxin
NPN21_RS27450	80729..80878	+	150	Protein_110	plasmid maintenance protein Mok	-
NPN21_RS27455	80820..80945	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NPN21_RS27460	81264..81560	-	297	Protein_112	hypothetical protein	-
NPN21_RS27465	81860..82156	+	297	WP_001272251.1	hypothetical protein	-
NPN21_RS27470	82267..83088	+	822	WP_001234445.1	DUF932 domain-containing protein	-
NPN21_RS27475	83385..84032	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
NPN21_RS27480	84309..84692	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NPN21_RS27485	84883..85569	+	687	WP_015059009.1	PAS domain-containing protein	-
NPN21_RS27490	85663..85890	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-65	-	1..149214	149214

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252570 WP_001372321.1 NZ_CP101727:80820-80945 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT252570 NZ_CP101727:c80741-80676 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin