Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 80676..80945 | Replicon | plasmid pCTXM65_150040X1B1 |
Accession | NZ_CP101727 | ||
Organism | Klebsiella pneumoniae strain 150040X1B1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | NPN21_RS27455 | Protein ID | WP_001372321.1 |
Coordinates | 80820..80945 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 80676..80741 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPN21_RS27425 | 76386..76913 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
NPN21_RS27430 | 76971..77204 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
NPN21_RS27435 | 77265..79288 | + | 2024 | Protein_107 | ParB/RepB/Spo0J family partition protein | - |
NPN21_RS27440 | 79357..79791 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
NPN21_RS27445 | 79788..80507 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 80519..80743 | + | 225 | NuclAT_0 | - | - |
- | 80519..80743 | + | 225 | NuclAT_0 | - | - |
- | 80519..80743 | + | 225 | NuclAT_0 | - | - |
- | 80519..80743 | + | 225 | NuclAT_0 | - | - |
- | 80676..80741 | - | 66 | - | - | Antitoxin |
NPN21_RS27450 | 80729..80878 | + | 150 | Protein_110 | plasmid maintenance protein Mok | - |
NPN21_RS27455 | 80820..80945 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
NPN21_RS27460 | 81264..81560 | - | 297 | Protein_112 | hypothetical protein | - |
NPN21_RS27465 | 81860..82156 | + | 297 | WP_001272251.1 | hypothetical protein | - |
NPN21_RS27470 | 82267..83088 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
NPN21_RS27475 | 83385..84032 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
NPN21_RS27480 | 84309..84692 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
NPN21_RS27485 | 84883..85569 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
NPN21_RS27490 | 85663..85890 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-65 | - | 1..149214 | 149214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T252570 WP_001372321.1 NZ_CP101727:80820-80945 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT252570 NZ_CP101727:c80741-80676 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|