Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 45284..45537 | Replicon | plasmid pCTXM65_150040X1B1 |
| Accession | NZ_CP101727 | ||
| Organism | Klebsiella pneumoniae strain 150040X1B1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPN21_RS27215 | Protein ID | WP_001312851.1 |
| Coordinates | 45388..45537 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 45284..45343 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPN21_RS27175 (40944) | 40944..41009 | - | 66 | Protein_55 | helix-turn-helix domain-containing protein | - |
| NPN21_RS27180 (41062) | 41062..41766 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NPN21_RS27185 (41791) | 41791..41991 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NPN21_RS27190 (42011) | 42011..42757 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NPN21_RS27195 (42812) | 42812..43372 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NPN21_RS27200 (43504) | 43504..43704 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NPN21_RS27205 (44090) | 44090..44689 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NPN21_RS27210 (44751) | 44751..45083 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (45284) | 45284..45343 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (45284) | 45284..45343 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (45284) | 45284..45343 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (45284) | 45284..45343 | - | 60 | NuclAT_1 | - | Antitoxin |
| NPN21_RS27215 (45388) | 45388..45537 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NPN21_RS27220 (45821) | 45821..46069 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NPN21_RS27225 (46184) | 46184..46362 | + | 179 | Protein_65 | protein CopA/IncA | - |
| NPN21_RS27230 (46381) | 46381..47238 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NPN21_RS27235 (48177) | 48177..48830 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NPN21_RS27240 (48923) | 48923..49180 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NPN21_RS27245 (49113) | 49113..49514 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NPN21_RS27250 (49763) | 49763..50178 | + | 416 | Protein_70 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-65 | - | 1..149214 | 149214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252566 WP_001312851.1 NZ_CP101727:45388-45537 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252566 NZ_CP101727:c45343-45284 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
