Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 174922..175176 | Replicon | plasmid pOXA1041_035152 |
| Accession | NZ_CP101706 | ||
| Organism | Escherichia coli strain 035152 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NPL72_RS24645 | Protein ID | WP_001312851.1 |
| Coordinates | 174922..175071 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 175115..175176 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPL72_RS24615 (170169) | 170169..171080 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| NPL72_RS24620 (171091) | 171091..172311 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| NPL72_RS24625 (173018) | 173018..173632 | + | 615 | Protein_195 | VENN motif pre-toxin domain-containing protein | - |
| NPL72_RS24630 (173632) | 173632..174078 | - | 447 | Protein_196 | plasmid replication initiator RepA | - |
| NPL72_RS24635 (174071) | 174071..174145 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| NPL72_RS24640 (174381) | 174381..174638 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NPL72_RS24645 (174922) | 174922..175071 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (175115) | 175115..175176 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (175115) | 175115..175176 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (175115) | 175115..175176 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (175115) | 175115..175176 | + | 62 | NuclAT_0 | - | Antitoxin |
| NPL72_RS24650 (175315) | 175315..175497 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| NPL72_RS24655 (175598) | 175598..176214 | + | 617 | Protein_201 | IS1-like element IS1A family transposase | - |
| NPL72_RS24660 (176252) | 176252..177823 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| NPL72_RS24665 (177843) | 177843..178190 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NPL72_RS24670 (178190) | 178190..178867 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| NPL72_RS24675 (178922) | 178922..179011 | + | 90 | Protein_205 | IS1 family transposase | - |
| NPL72_RS24680 (179312) | 179312..179524 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / blaOXA-427 / qnrA1 / floR / tet(G) / rmtB / blaTEM-1B / tet(A) / sitABCD | senB / iutA / iucD / iucC / iucB / iucA | 1..223341 | 223341 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252543 WP_001312851.1 NZ_CP101706:c175071-174922 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT252543 NZ_CP101706:175115-175176 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
