Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1187129..1187856 | Replicon | chromosome |
Accession | NZ_CP101705 | ||
Organism | Escherichia coli strain 035152 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | NPL72_RS05830 | Protein ID | WP_000547564.1 |
Coordinates | 1187129..1187440 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NPL72_RS05835 | Protein ID | WP_000126294.1 |
Coordinates | 1187437..1187856 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPL72_RS05800 (1182271) | 1182271..1183980 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
NPL72_RS05805 (1183990) | 1183990..1184532 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
NPL72_RS05810 (1184532) | 1184532..1185299 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
NPL72_RS05815 (1185296) | 1185296..1185706 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
NPL72_RS05820 (1185699) | 1185699..1186169 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
NPL72_RS05825 (1186194) | 1186194..1186955 | + | 762 | WP_001026446.1 | hypothetical protein | - |
NPL72_RS05830 (1187129) | 1187129..1187440 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NPL72_RS05835 (1187437) | 1187437..1187856 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
NPL72_RS05840 (1187970) | 1187970..1189394 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
NPL72_RS05845 (1189403) | 1189403..1190860 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
NPL72_RS05850 (1191120) | 1191120..1192130 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
NPL72_RS05855 (1192279) | 1192279..1192806 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T252531 WP_000547564.1 NZ_CP101705:1187129-1187440 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT252531 WP_000126294.1 NZ_CP101705:1187437-1187856 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|