Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 773177..773870 | Replicon | chromosome |
| Accession | NZ_CP101705 | ||
| Organism | Escherichia coli strain 035152 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | U9ZN09 |
| Locus tag | NPL72_RS03775 | Protein ID | WP_000415585.1 |
| Coordinates | 773177..773473 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NPL72_RS03780 | Protein ID | WP_000650107.1 |
| Coordinates | 773475..773870 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPL72_RS03740 (768311) | 768311..768790 | + | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
| NPL72_RS03745 (768793) | 768793..769503 | + | 711 | WP_000834030.1 | hypothetical protein | - |
| NPL72_RS03750 (769510) | 769510..769842 | + | 333 | WP_000914690.1 | DUF2645 family protein | - |
| NPL72_RS03755 (769888) | 769888..771237 | - | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
| NPL72_RS03760 (771234) | 771234..771893 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
| NPL72_RS03765 (772045) | 772045..772437 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NPL72_RS03770 (772490) | 772490..772972 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NPL72_RS03775 (773177) | 773177..773473 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NPL72_RS03780 (773475) | 773475..773870 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NPL72_RS03785 (774003) | 774003..775610 | + | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
| NPL72_RS03790 (775748) | 775748..778006 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T252527 WP_000415585.1 NZ_CP101705:773177-773473 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT252527 WP_000650107.1 NZ_CP101705:773475-773870 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|