Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 335209..335798 | Replicon | chromosome |
Accession | NZ_CP101703 | ||
Organism | Xanthomonas oryzae pv. oryzae strain CIX4506 |
Toxin (Protein)
Gene name | graT | Uniprot ID | G7TIR7 |
Locus tag | NO458_RS01495 | Protein ID | WP_012443754.1 |
Coordinates | 335209..335490 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NO458_RS01500 | Protein ID | WP_011260746.1 |
Coordinates | 335508..335798 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO458_RS01490 (NO458_01490) | 332862..335114 | + | 2253 | WP_012443753.1 | exodeoxyribonuclease V subunit alpha | - |
NO458_RS01495 (NO458_01495) | 335209..335490 | + | 282 | WP_012443754.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NO458_RS01500 (NO458_01500) | 335508..335798 | + | 291 | WP_011260746.1 | HigA family addiction module antitoxin | Antitoxin |
NO458_RS01505 (NO458_01505) | 336727..338121 | + | 1395 | WP_027703652.1 | type III secretion system effector XopQ | - |
NO458_RS01510 (NO458_01510) | 338224..338411 | - | 188 | Protein_296 | hypothetical protein | - |
NO458_RS01515 (NO458_01515) | 338571..338903 | - | 333 | WP_011260743.1 | hypothetical protein | - |
NO458_RS01520 (NO458_01520) | 339158..339463 | + | 306 | WP_224229802.1 | hypothetical protein | - |
NO458_RS01525 (NO458_01525) | 339613..340035 | + | 423 | WP_033013301.1 | PAAR domain-containing protein | - |
NO458_RS01530 (NO458_01530) | 340038..340514 | + | 477 | WP_011260741.1 | DUF4123 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11066.83 Da Isoelectric Point: 10.5318
>T252516 WP_012443754.1 NZ_CP101703:335209-335490 [Xanthomonas oryzae pv. oryzae]
VIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
VIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|