Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2587924..2588526 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3V4SQH3 |
Locus tag | NOV91_RS12705 | Protein ID | WP_001159628.1 |
Coordinates | 2587924..2588235 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NOV91_RS12710 | Protein ID | WP_000362050.1 |
Coordinates | 2588236..2588526 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS12670 (2583037) | 2583037..2583636 | + | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
NOV91_RS12675 (2583630) | 2583630..2584502 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NOV91_RS12680 (2584499) | 2584499..2584936 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
NOV91_RS12685 (2584981) | 2584981..2585922 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NOV91_RS12690 (2585937) | 2585937..2586383 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NOV91_RS12695 (2586380) | 2586380..2586691 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
NOV91_RS12700 (2586777) | 2586777..2587706 | - | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
NOV91_RS12705 (2587924) | 2587924..2588235 | + | 312 | WP_001159628.1 | hypothetical protein | Toxin |
NOV91_RS12710 (2588236) | 2588236..2588526 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NOV91_RS12715 (2588573) | 2588573..2589502 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NOV91_RS12720 (2589499) | 2589499..2590134 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NOV91_RS12725 (2590131) | 2590131..2591033 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12376.29 Da Isoelectric Point: 9.4460
>T252495 WP_001159628.1 NZ_CP101689:2587924-2588235 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT252495 WP_000362050.1 NZ_CP101689:2588236-2588526 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|