Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2585937..2586691 | Replicon | chromosome |
| Accession | NZ_CP101689 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NOV91_RS12695 | Protein ID | WP_000558166.1 |
| Coordinates | 2586380..2586691 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NOV91_RS12690 | Protein ID | WP_001259011.1 |
| Coordinates | 2585937..2586383 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV91_RS12660 (2581113) | 2581113..2582009 | + | 897 | WP_017441898.1 | sugar kinase | - |
| NOV91_RS12665 (2582043) | 2582043..2582846 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NOV91_RS12670 (2583037) | 2583037..2583636 | + | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| NOV91_RS12675 (2583630) | 2583630..2584502 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NOV91_RS12680 (2584499) | 2584499..2584936 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NOV91_RS12685 (2584981) | 2584981..2585922 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NOV91_RS12690 (2585937) | 2585937..2586383 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NOV91_RS12695 (2586380) | 2586380..2586691 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NOV91_RS12700 (2586777) | 2586777..2587706 | - | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| NOV91_RS12705 (2587924) | 2587924..2588235 | + | 312 | WP_001159628.1 | hypothetical protein | - |
| NOV91_RS12710 (2588236) | 2588236..2588526 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NOV91_RS12715 (2588573) | 2588573..2589502 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NOV91_RS12720 (2589499) | 2589499..2590134 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NOV91_RS12725 (2590131) | 2590131..2591033 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T252494 WP_000558166.1 NZ_CP101689:c2586691-2586380 [Salmonella enterica subsp. enterica serovar Mbandaka]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT252494 WP_001259011.1 NZ_CP101689:c2586383-2585937 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|