Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 328151..328878 | Replicon | chromosome |
| Accession | NZ_CP101689 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A418Z4H3 |
| Locus tag | NOV91_RS01580 | Protein ID | WP_017441960.1 |
| Coordinates | 328151..328462 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NOV91_RS01585 | Protein ID | WP_000561389.1 |
| Coordinates | 328459..328878 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV91_RS01550 (323323) | 323323..324045 | - | 723 | WP_017441965.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
| NOV91_RS01555 (324726) | 324726..325121 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| NOV91_RS01560 (325449) | 325449..325925 | + | 477 | WP_017441964.1 | hypothetical protein | - |
| NOV91_RS01565 (326077) | 326077..326229 | + | 153 | WP_153257556.1 | hypothetical protein | - |
| NOV91_RS01570 (326592) | 326592..327374 | + | 783 | WP_023242818.1 | DUF2971 domain-containing protein | - |
| NOV91_RS01575 (327673) | 327673..327972 | - | 300 | WP_017441961.1 | hypothetical protein | - |
| NOV91_RS01580 (328151) | 328151..328462 | + | 312 | WP_017441960.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NOV91_RS01585 (328459) | 328459..328878 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NOV91_RS01590 (329134) | 329134..329628 | + | 495 | WP_077907251.1 | glycosyltransferase | - |
| NOV91_RS01595 (329625) | 329625..329783 | + | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
| NOV91_RS01600 (330019) | 330019..330438 | - | 420 | WP_017441959.1 | GNAT family N-acetyltransferase | - |
| NOV91_RS01605 (330809) | 330809..331078 | + | 270 | WP_077907250.1 | hypothetical protein | - |
| NOV91_RS01610 (331244) | 331244..331384 | + | 141 | WP_031615664.1 | hypothetical protein | - |
| NOV91_RS01615 (331530) | 331530..332058 | - | 529 | Protein_318 | transposase | - |
| NOV91_RS01620 (332078) | 332078..332170 | - | 93 | WP_230855586.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 331530..331868 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12453.27 Da Isoelectric Point: 10.1599
>T252484 WP_017441960.1 NZ_CP101689:328151-328462 [Salmonella enterica subsp. enterica serovar Mbandaka]
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT252484 WP_000561389.1 NZ_CP101689:328459-328878 [Salmonella enterica subsp. enterica serovar Mbandaka]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|