Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41963..42217 | Replicon | plasmid pM171-1.1 |
| Accession | NZ_CP101667 | ||
| Organism | Escherichia coli strain M171-1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NO473_RS22470 | Protein ID | WP_001312851.1 |
| Coordinates | 42068..42217 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 41963..42024 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO473_RS22455 (39916) | 39916..40659 | + | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
| NO473_RS22460 (40714) | 40714..41274 | + | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| NO473_RS22465 (41409) | 41409..41621 | + | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| - (41963) | 41963..42024 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (41963) | 41963..42024 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (41963) | 41963..42024 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (41963) | 41963..42024 | - | 62 | NuclAT_1 | - | Antitoxin |
| NO473_RS22470 (42068) | 42068..42217 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NO473_RS22475 (42485) | 42485..42742 | + | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| NO473_RS22480 (42974) | 42974..43048 | + | 75 | WP_061357229.1 | RepA leader peptide Tap | - |
| NO473_RS22485 (43041) | 43041..43898 | + | 858 | WP_039002220.1 | incFII family plasmid replication initiator RepA | - |
| NO473_RS22490 (44864) | 44864..45115 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NO473_RS22495 (45112) | 45112..45399 | + | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NO473_RS22500 (45474) | 45474..45662 | - | 189 | Protein_56 | IS3 family transposase | - |
| NO473_RS22505 (45696) | 45696..46196 | - | 501 | Protein_57 | Tn3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) | - | 1..122198 | 122198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252478 WP_001312851.1 NZ_CP101667:42068-42217 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT252478 NZ_CP101667:c42024-41963 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|