Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41963..42217 Replicon plasmid pM171-1.1
Accession NZ_CP101667
Organism Escherichia coli strain M171-1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NO473_RS22470 Protein ID WP_001312851.1
Coordinates 42068..42217 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 41963..42024 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO473_RS22455 (39916) 39916..40659 + 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -
NO473_RS22460 (40714) 40714..41274 + 561 WP_000139310.1 fertility inhibition protein FinO -
NO473_RS22465 (41409) 41409..41621 + 213 WP_001541896.1 ANR family transcriptional regulator -
- (41963) 41963..42024 - 62 NuclAT_1 - Antitoxin
- (41963) 41963..42024 - 62 NuclAT_1 - Antitoxin
- (41963) 41963..42024 - 62 NuclAT_1 - Antitoxin
- (41963) 41963..42024 - 62 NuclAT_1 - Antitoxin
NO473_RS22470 (42068) 42068..42217 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NO473_RS22475 (42485) 42485..42742 + 258 WP_001541895.1 replication regulatory protein RepA -
NO473_RS22480 (42974) 42974..43048 + 75 WP_061357229.1 RepA leader peptide Tap -
NO473_RS22485 (43041) 43041..43898 + 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
NO473_RS22490 (44864) 44864..45115 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NO473_RS22495 (45112) 45112..45399 + 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin -
NO473_RS22500 (45474) 45474..45662 - 189 Protein_56 IS3 family transposase -
NO473_RS22505 (45696) 45696..46196 - 501 Protein_57 Tn3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) - 1..122198 122198


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252478 WP_001312851.1 NZ_CP101667:42068-42217 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT252478 NZ_CP101667:c42024-41963 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References