Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 6485..6911 | Replicon | plasmid pM171-1.1 |
| Accession | NZ_CP101667 | ||
| Organism | Escherichia coli strain M171-1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NO473_RS22275 | Protein ID | WP_001372321.1 |
| Coordinates | 6786..6911 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 6485..6709 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO473_RS22230 (1716) | 1716..1943 | + | 228 | WP_071961421.1 | hypothetical protein | - |
| NO473_RS22235 (2184) | 2184..2390 | + | 207 | WP_000275853.1 | hypothetical protein | - |
| NO473_RS22240 (2416) | 2416..2955 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
| NO473_RS22245 (3012) | 3012..3245 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| NO473_RS22250 (3310) | 3310..5268 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
| NO473_RS22255 (5323) | 5323..5757 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| NO473_RS22260 (5754) | 5754..6516 | + | 763 | Protein_8 | plasmid SOS inhibition protein A | - |
| NO473_RS22265 (6485) | 6485..6673 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (6485) | 6485..6709 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (6485) | 6485..6709 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (6485) | 6485..6709 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (6485) | 6485..6709 | + | 225 | NuclAT_0 | - | Antitoxin |
| NO473_RS22270 (6695) | 6695..6844 | + | 150 | Protein_10 | plasmid maintenance protein Mok | - |
| NO473_RS22275 (6786) | 6786..6911 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NO473_RS22280 (7131) | 7131..7361 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| NO473_RS22285 (7359) | 7359..7532 | - | 174 | Protein_13 | hypothetical protein | - |
| NO473_RS22290 (7602) | 7602..7808 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| NO473_RS22295 (7833) | 7833..8120 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| NO473_RS22300 (8242) | 8242..9063 | + | 822 | WP_072795862.1 | DUF932 domain-containing protein | - |
| NO473_RS22305 (9360) | 9360..9962 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| NO473_RS22310 (10281) | 10281..10664 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NO473_RS22315 (10851) | 10851..11540 | + | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) | - | 1..122198 | 122198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T252475 WP_001372321.1 NZ_CP101667:6786-6911 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT252475 NZ_CP101667:6485-6709 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|