Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3672482..3673175 | Replicon | chromosome |
Accession | NZ_CP101666 | ||
Organism | Escherichia coli strain M171-1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NO473_RS17885 | Protein ID | WP_000415584.1 |
Coordinates | 3672482..3672778 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NO473_RS17890 | Protein ID | WP_000650107.1 |
Coordinates | 3672780..3673175 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NO473_RS17850 (3667570) | 3667570..3667884 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NO473_RS17855 (3667915) | 3667915..3668496 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NO473_RS17860 (3668815) | 3668815..3669147 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
NO473_RS17865 (3669193) | 3669193..3670542 | - | 1350 | WP_130062318.1 | quorum sensing histidine kinase QseC | - |
NO473_RS17870 (3670539) | 3670539..3671198 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NO473_RS17875 (3671350) | 3671350..3671742 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NO473_RS17880 (3671795) | 3671795..3672277 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NO473_RS17885 (3672482) | 3672482..3672778 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NO473_RS17890 (3672780) | 3672780..3673175 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NO473_RS17895 (3673308) | 3673308..3674915 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NO473_RS17900 (3675053) | 3675053..3677311 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T252472 WP_000415584.1 NZ_CP101666:3672482-3672778 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT252472 WP_000650107.1 NZ_CP101666:3672780-3673175 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|