Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 1959663..1960357 Replicon chromosome
Accession NZ_CP101666
Organism Escherichia coli strain M171-1

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag NO473_RS09605 Protein ID WP_001263493.1
Coordinates 1959663..1960061 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag NO473_RS09610 Protein ID WP_000554757.1
Coordinates 1960064..1960357 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (1955323) 1955323..1955403 - 81 NuclAT_12 - -
- (1955323) 1955323..1955403 - 81 NuclAT_12 - -
- (1955323) 1955323..1955403 - 81 NuclAT_12 - -
- (1955323) 1955323..1955403 - 81 NuclAT_12 - -
NO473_RS09575 (1954663) 1954663..1955907 - 1245 WP_000189541.1 esterase FrsA -
NO473_RS09580 (1955999) 1955999..1956457 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NO473_RS09585 (1956718) 1956718..1958175 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
NO473_RS09590 (1958232) 1958232..1958753 - 522 Protein_1874 peptide chain release factor H -
NO473_RS09595 (1958752) 1958752..1958955 - 204 Protein_1875 RtcB family protein -
NO473_RS09600 (1959201) 1959201..1959653 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
NO473_RS09605 (1959663) 1959663..1960061 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NO473_RS09610 (1960064) 1960064..1960357 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NO473_RS09615 (1960409) 1960409..1961464 - 1056 WP_001226164.1 DNA polymerase IV -
NO473_RS09620 (1961535) 1961535..1962320 - 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
NO473_RS09625 (1962292) 1962292..1964004 + 1713 Protein_1881 flagellar biosynthesis protein FlhA -
NO473_RS09630 (1964228) 1964228..1964725 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 1958701..1978716 20015


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T252464 WP_001263493.1 NZ_CP101666:c1960061-1959663 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT252464 WP_000554757.1 NZ_CP101666:c1960357-1960064 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References