Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6196089..6196684 | Replicon | chromosome |
Accession | NZ_CP101656 | ||
Organism | Pseudomonas aeruginosa strain L1a |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | MBA02_RS28675 | Protein ID | WP_003113526.1 |
Coordinates | 6196406..6196684 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MBA02_RS28670 | Protein ID | WP_003113527.1 |
Coordinates | 6196089..6196394 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBA02_RS28640 (MBA02_028640) | 6191202..6191492 | - | 291 | WP_033992920.1 | DUF5447 family protein | - |
MBA02_RS28645 (MBA02_028645) | 6191704..6191976 | - | 273 | WP_003115921.1 | hypothetical protein | - |
MBA02_RS28650 (MBA02_028650) | 6192102..6192371 | + | 270 | WP_071536122.1 | hypothetical protein | - |
MBA02_RS28655 (MBA02_028655) | 6192506..6193603 | + | 1098 | WP_169917322.1 | protein phosphatase 2C domain-containing protein | - |
MBA02_RS28660 (MBA02_028660) | 6193606..6194655 | + | 1050 | WP_003113529.1 | serine/threonine-protein kinase | - |
MBA02_RS28665 (MBA02_028665) | 6194652..6195725 | + | 1074 | WP_003113528.1 | serine/threonine-protein kinase | - |
MBA02_RS28670 (MBA02_028670) | 6196089..6196394 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
MBA02_RS28675 (MBA02_028675) | 6196406..6196684 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MBA02_RS28680 (MBA02_028680) | 6196737..6196865 | - | 129 | Protein_5661 | integrase | - |
MBA02_RS28685 (MBA02_028685) | 6197013..6199241 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
MBA02_RS28690 (MBA02_028690) | 6199311..6199958 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
MBA02_RS28695 (MBA02_028695) | 6200020..6201258 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T252453 WP_003113526.1 NZ_CP101656:c6196684-6196406 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|