Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 155544..156298 | Replicon | chromosome |
| Accession | NZ_CP101647 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain KCID6 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NOQ94_RS00730 | Protein ID | WP_000558166.1 |
| Coordinates | 155544..155855 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NOQ94_RS00735 | Protein ID | WP_001259011.1 |
| Coordinates | 155852..156298 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOQ94_RS00700 (151202) | 151202..152104 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NOQ94_RS00705 (152101) | 152101..152736 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NOQ94_RS00710 (152733) | 152733..153662 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NOQ94_RS00715 (153709) | 153709..153999 | - | 291 | WP_000362052.1 | DNA-binding transcriptional regulator | - |
| NOQ94_RS00720 (154000) | 154000..154311 | - | 312 | WP_023138876.1 | hypothetical protein | - |
| NOQ94_RS00725 (154529) | 154529..155458 | + | 930 | WP_001127698.1 | alpha/beta hydrolase | - |
| NOQ94_RS00730 (155544) | 155544..155855 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NOQ94_RS00735 (155852) | 155852..156298 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NOQ94_RS00740 (156313) | 156313..157254 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NOQ94_RS00745 (157299) | 157299..157736 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| NOQ94_RS00750 (157733) | 157733..158605 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NOQ94_RS00755 (158599) | 158599..159198 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NOQ94_RS00760 (159389) | 159389..160192 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NOQ94_RS00765 (160226) | 160226..161122 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T252414 WP_000558166.1 NZ_CP101647:155544-155855 [Salmonella enterica subsp. enterica serovar Kentucky]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT252414 WP_001259011.1 NZ_CP101647:155852-156298 [Salmonella enterica subsp. enterica serovar Kentucky]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|