Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2718115..2718637 | Replicon | chromosome |
Accession | NZ_CP101643 | ||
Organism | Lacticaseibacillus rhamnosus strain CLK 101 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C2JUK2 |
Locus tag | NOS86_RS12550 | Protein ID | WP_005687756.1 |
Coordinates | 2718377..2718637 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C2JUK3 |
Locus tag | NOS86_RS12545 | Protein ID | WP_005687754.1 |
Coordinates | 2718115..2718384 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOS86_RS12525 (NOS86_12525) | 2713701..2714270 | - | 570 | WP_005687747.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
NOS86_RS12530 (NOS86_12530) | 2714283..2714793 | - | 511 | Protein_2428 | transcriptional regulator GutM | - |
NOS86_RS12535 (NOS86_12535) | 2714794..2716662 | - | 1869 | WP_014571687.1 | HTH domain-containing protein | - |
NOS86_RS12540 (NOS86_12540) | 2716689..2717489 | - | 801 | WP_005690776.1 | SDR family oxidoreductase | - |
NOS86_RS12545 (NOS86_12545) | 2718115..2718384 | + | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NOS86_RS12550 (NOS86_12550) | 2718377..2718637 | + | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
NOS86_RS12555 (NOS86_12555) | 2718848..2719576 | - | 729 | WP_014571689.1 | L-ribulose-5-phosphate 4-epimerase | - |
NOS86_RS12560 (NOS86_12560) | 2719773..2720594 | + | 822 | WP_005690770.1 | Cof-type HAD-IIB family hydrolase | - |
NOS86_RS12565 (NOS86_12565) | 2720661..2721548 | - | 888 | WP_014571690.1 | L-ribulose-5-phosphate 3-epimerase | - |
NOS86_RS12570 (NOS86_12570) | 2721733..2722512 | - | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NOS86_RS12575 (NOS86_12575) | 2722580..2723221 | - | 642 | WP_005690763.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T252412 WP_005687756.1 NZ_CP101643:2718377-2718637 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N526 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N594 |