Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 49832..50071 Replicon plasmid pDC71-3
Accession NZ_CP101618
Organism Escherichia coli strain DC71

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag NOF56_RS24160 Protein ID WP_023144756.1
Coordinates 49937..50071 (+) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 49832..49892 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOF56_RS24135 (45923) 45923..46669 + 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
NOF56_RS24140 (46724) 46724..47284 + 561 WP_000139341.1 fertility inhibition protein FinO -
NOF56_RS24145 (47318) 47318..48664 - 1347 WP_000483766.1 IS4-like element IS4 family transposase -
NOF56_RS24150 (48854) 48854..49066 + 213 WP_013023861.1 hypothetical protein -
NOF56_RS24155 (49579) 49579..49865 + 287 Protein_53 DUF2726 domain-containing protein -
- (49832) 49832..49892 - 61 NuclAT_0 - Antitoxin
- (49832) 49832..49892 - 61 NuclAT_0 - Antitoxin
- (49832) 49832..49892 - 61 NuclAT_0 - Antitoxin
- (49832) 49832..49892 - 61 NuclAT_0 - Antitoxin
NOF56_RS24160 (49937) 49937..50071 + 135 WP_023144756.1 Hok/Gef family protein Toxin
NOF56_RS24165 (50368) 50368..50622 + 255 WP_000083850.1 replication regulatory protein RepA -
NOF56_RS24170 (50782) 50782..51528 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NOF56_RS24175 (51543) 51543..53081 - 1539 WP_255862077.1 IS21-like element ISEc12 family transposase -
NOF56_RS24180 (53312) 53312..53443 + 132 Protein_58 protein CopA/IncA -
NOF56_RS24185 (53443) 53443..53517 + 75 WP_031943482.1 RepA leader peptide Tap -
NOF56_RS24190 (53510) 53510..54367 + 858 WP_000130640.1 incFII family plasmid replication initiator RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aadA5 / sul1 / tet(B) - 1..72929 72929
- inside IScluster/Tn mph(A) / aadA5 / sul1 / tet(B) - 47318..72848 25530


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T252402 WP_023144756.1 NZ_CP101618:49937-50071 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT252402 NZ_CP101618:c49892-49832 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References